KEGG   Brachypodium distachyon: 100841774Help
Entry
100841774         CDS       T01717                                 

Definition
(RefSeq) acyl-coenzyme A oxidase 2, peroxisomal isoform X1
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00071  Fatty acid degradation
bdi00592  alpha-Linolenic acid metabolism
bdi01040  Biosynthesis of unsaturated fatty acids
bdi01100  Metabolic pathways
bdi01110  Biosynthesis of secondary metabolites
bdi01212  Fatty acid metabolism
bdi04146  Peroxisome
Module
bdi_M00087  beta-Oxidation
bdi_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:bdi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100841774
   00592 alpha-Linolenic acid metabolism
    100841774
   01040 Biosynthesis of unsaturated fatty acids
    100841774
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100841774
Enzymes [BR:bdi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     100841774
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_dh_N Nnf1
Motif
Other DBs
NCBI-GeneID: 100841774
NCBI-ProteinID: XP_003577380
UniProt: I1IKI2
Position
4
AA seq 692 aa AA seqDB search
MATTSSRSNSNPGSDDDDSTPAMRRLRRLSLHLLQPEGPASSHLAPAACAARRRLEADAA
ALAAYMRGRHRAMQARVYEFYVARPELQTPVELPTAAHRELCFRQMAALVRDAGVRPLSL
MAADPAEYFAVMEAVGGLDISLAIKVGVQYSLWGGSIINLGTKKHKEKFFDKIDNLEYPG
CFAMTELHHGSNVQALQTTATFDPVNDEFIIDTPNDGAIKWWIGNAALHGKFATVFARLI
LPLQGKGGEPADMGIHAFIVPIRDLETHVVLPGIEINDCGHKIGLNGVDNGALRFRSVRI
PRDNLLNRFGDVARDGKYTSSLPTINKRFAATLGELVGGRVGLAYSSVGVLKVAVTIAVR
YALLRQQFGPPKQPEISVLDYQSHQHKLMPMLASAYAFHFARGYLVDKYSEMKKTNDEDL
SADVHVLSSGLKSYITSYTAKSISICRESCGGHGYAAVNRFGGLRNDHDIFQTFEGDNTV
LLQQVAGDLLKQYQQKFKGGTISVTWSYLRESMSTYLSQPNPVTARWEGEDHLRDPNFQL
DAFRYRTSRLLHSVAARLQKHMKTLGGFGAWNRCLNHLLTLAESHIESIILARFIEAVKS
CPDEKTREVLKLVCDLYALDRIWNDIGTYRNVDYVAPNKAKAIHKLVDYLSYQVRLVARE
LVDAFDLPDQIIRAPIGMQSEAYAQYTQFVGF
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atggccaccacgtcgtcccgctccaactccaaccccggctccgacgacgacgactctaca
ccagccatgcgccgactccgccgcctctccctccacctcctccagcccgagggccccgct
tcctcccacctagcccccgcggcgtgcgcggcgaggcggcgcctggaggcggacgcggcg
gcgctggcggcgtacatgaggggccggcaccgcgcgatgcaggcgcgggtgtacgagttc
tacgtggcgcggccggagctgcagacccccgtggagctccccacggcggcgcaccgggag
ctctgcttccgccagatggccgcgctggtgcgggacgccggggtgcgcccgctcagcctc
atggcggccgaccccgccgagtacttcgccgtcatggaggccgtcggcgggctcgacatc
tccctcgccatcaaggtcggcgtccagtacagtctatggggtggttctataataaatcta
ggaacaaagaagcataaagagaagttcttcgacaagatcgacaatttggagtatccaggc
tgctttgccatgacagaactgcatcatggatccaatgttcaagccctgcagactactgct
acatttgatcctgttaatgatgagttcattattgataccccaaatgatggagccattaag
tggtggatcggcaatgcagctctccatggaaaattcgccactgtttttgcaaggttgatt
ttaccccttcagggaaaaggaggggaacctgctgacatgggcattcatgctttcattgtc
ccgatacgggaccttgaaacacatgtggttcttccaggaattgagatcaatgattgtggg
cacaagataggcctaaatggtgtagataatggtgcactgaggttccgttcagttaggata
ccccgggataatcttctgaaccgatttggtgatgttgcaagagatggaaaatacacaagc
agtctccccacaattaacaaaaggtttgcagcaactcttggtgagcttgttgggggacga
gttggtcttgcatatagctctgtgggggtactcaaagttgcagtaaccattgctgttaga
tatgctttattgcgtcagcagtttggtccacctaagcagcctgaaatcagtgtgctggat
taccaatctcaccagcacaaactaatgcctatgctggcatcggcatacgcatttcacttt
gccagaggatatttggtggataagtactcggaaatgaagaaaactaatgatgaggatctt
agcgctgatgtccatgtactttcatctgggttgaaatcttacataacttcatacacagca
aaatctattagcatatgccgggagtcgtgtggtggccatgggtatgctgctgttaatcgt
tttggtggtctgcgcaatgaccatgatatattccaaacattcgaaggagacaatacagtt
cttttgcagcaggttgctggagatctcctgaagcaataccaacaaaaatttaagggggga
acaatctcagtcacctggagctacttgagggaatccatgagcacctacttgtcccagcct
aatcccgttacggctcgatgggaaggggaagatcatctacgagatcccaacttccagctg
gatgcattcaggtaccgaacatctcggttactgcatagtgttgctgctcgactccagaag
catatgaagacacttggaggttttggtgcgtggaacagatgtttaaaccatctgctcaca
cttgcagagtcacacattgagtctatcatccttgcaaggtttatagaagcagtgaaaagc
tgccctgacgagaaaacacgtgaagtgctgaagctggtgtgcgacctctacgccctcgac
aggatttggaatgacatcgggacatatcgcaatgtagactacgtagcgccaaacaaagcc
aaggctatccataaactggtagactacctcagttaccaagtgaggcttgtggcacgagaa
cttgtcgacgccttcgatcttcctgaccagatcatccgcgcgccgatcggcatgcaatca
gaggcctatgcccagtatacacagtttgtcggcttctag

DBGET integrated database retrieval system