KEGG   Brachypodium distachyon: 100843706Help
Entry
100843706         CDS       T01717                                 

Definition
(RefSeq) methionine--tRNA ligase, chloroplastic/mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00450  Selenocompound metabolism
bdi00970  Aminoacyl-tRNA biosynthesis
bdi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bdi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    100843706
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    100843706
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bdi01007]
    100843706
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bdi03016]
    100843706
Enzymes [BR:bdi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     100843706
Amino acid related enzymes [BR:bdi01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   100843706
Transfer RNA biogenesis [BR:bdi03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    100843706
 Prokaryotic type
   Other AARSs
    100843706
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-GeneID: 100843706
NCBI-ProteinID: XP_003558528
UniProt: I1H8B2
Position
1
AA seq 600 aa AA seqDB search
MAAGRAFFCVPSSIGATARRLAFASPPPRPLASAPHRRGRGRCCASISSSSDASASAPPP
YVLTTPLYYVNAPPHMGSAYTTIAADAVARFQRLLQKKVIFITGTDEHGEKIATSAEASG
RNPKEHCDTISNSYKMLWADLDIEYDKFIRTTDPKHEAVVNDFYSRVLSSGDLYRADYEG
LYCVGCEEYKDEKELVENNCCPVHLKPCVPRKEDNYFFALSKYQHKLEELLRRNPDFVRP
SYRLHEVQGWIKSGLRDFSISRASVEWGIPVPNDTKQTIYVWFDALLGYLSASLDDGEQA
SLQKAVDRGWPASLHLIGKDILRFHAVYWPAMLMSAGISLPDAVFGHGFLTKDGMKMGKS
LGNTLEPKDLVDRFGADAVRYFFLREVEFGNDGDYSEGRFINTVNAHLANTIGNLLNRTL
GLLKKNCGSMLAFDSMAAADGSSFKNSVESLVDKAKGHYENLSLTSACETVLEIGNLGNL
YIDEQAPWSCFKQGGESAEKAAKDLVIILETMRIIAIALSPVTPSLSLRIYTQLGFTEDQ
FSTLTWEDTKWGVLKAGQAMMEPKPIFAKIETEAEEKDQATPKAAKGGKKKSGSKGLVEA
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atggccgcagggcgggccttcttctgtgtcccgtcctcaatcggggccaccgcccgccgc
ttagccttcgcctcaccccctccccggcccctcgcatccgctccccaccgccgcggccgc
ggccgctgttgcgcatccatctcttcgtcctccgatgcctccgcctccgcgccgccaccg
tacgtgctcaccacgccgctctactacgtcaacgcgccgccgcacatgggcagcgcatac
acaaccatcgccgccgacgccgtcgcccgcttccagagattgctacagaagaaggttata
ttcattactggaacagatgagcatggtgagaagattgccacttcagcagaggctagtggt
agaaaccccaaggagcattgcgacacaatttcaaattcatacaagatgctttgggctgat
ctagacatagaatacgacaagtttattcgcacaactgatcctaaacatgaggctgttgtt
aatgacttctattctagagtactaagcagtggtgacctatatagagctgattatgaaggg
ctttactgtgtgggctgcgaggagtacaaagatgagaaagagttagtggaaaacaattgc
tgtcctgtgcatctgaagccttgtgtacctagaaaggaagataactatttctttgcctta
tcaaaatatcagcataagttagaagagctactgagaagaaatcccgattttgtaaggcct
tcatatcgcttgcatgaggtccaaggctggattaaaagtggattgagagacttttctatt
tctcgtgcatctgtagagtggggtattccagtgccaaatgacaccaaacaaacaatatat
gtgtggtttgatgccttattaggttacctttcagcgtctctagatgatggagaacaggca
agtttacagaaagctgttgatcgcggttggcctgcctctttacacctgataggaaaggac
atattgcggtttcatgcagtttattggccagcaatgttaatgtcagcagggataagtctt
cctgatgcagtttttggtcatggattcttgactaaggatggcatgaagatgggaaaatca
ttaggcaatacacttgaaccaaaggatttggttgacagatttggagctgatgctgttagg
tacttcttcctgcgggaagtagaattcggcaatgatggggactattcagaagggcgtttt
atcaatacagtcaatgcacatcttgctaacacaattgggaatctccttaatcgcacactg
gggctcctaaaaaagaattgtggttccatgttagcttttgattcaatggctgctgcagat
ggaagttcgttcaagaatagtgttgaaagcttggtggacaaggcgaagggccattatgaa
aatctttctttgacgtctgcatgtgaaactgttctagaaattggtaacttgggaaacttg
tacattgatgagcaagcaccatggtcttgtttcaagcaaggaggtgagagtgctgaaaag
gctgcaaaggatcttgtcattattctagagacaatgagaataattgcaattgcgctgtct
ccagtcactcccagcctttccttgaggatttatacacagcttggtttcacagaagaccag
tttagtacactgacatgggaggataccaaatggggagtccttaaagcaggccaggcaatg
atggaaccgaagccaattttcgcaaaaatagaaaccgaggctgaagagaaagatcaagca
actccaaaggccgcgaagggcgggaagaagaaatcaggtagtaaaggacttgttgaggca
tga

DBGET integrated database retrieval system