KEGG   Brachypodium distachyon: 100844752Help
Entry
100844752         CDS       T01717                                 

Definition
(RefSeq) uncharacterized protein LOC100844752
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00260  Glycine, serine and threonine metabolism
bdi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bdi01100  Metabolic pathways
bdi01110  Biosynthesis of secondary metabolites
bdi01230  Biosynthesis of amino acids
Module
bdi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100844752
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    100844752
Enzymes [BR:bdi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     100844752
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 100844752
NCBI-ProteinID: XP_003563590
UniProt: I1GX60
Position
1
AA seq 490 aa AA seqDB search
MAAASIALHPPRLQGPGKAALPPRIPNRSRVTVSGTRSFATRAGSNPGNVSIPKQWYNLV
ADLPVKPPPQLHPQTHQPLKPSDLSPLFPDELIRQELTEERFVDIPEEVRDVYELWRPTP
LIRAKRLEKLLGTPAKIYYKYEGTSPAGSHKANTAVPQAFYNAAAGVKSVVTETGAGQWG
SALSFASTLFGLTCEVWQVRASYDQKPYRRLMMETWGAKVHPSPSEATESGRKLLAADPS
SPGSLGMAISEAVEVAATNGDTKYCLGSVLNHVLLHQTVIGEECLEQLAAIGDTPDVVIG
CTGGGSNFGGLAFPFMREKLAGRINPVFKAVEPAACPTLTKGVYAYDYGDTAGLTPLMKM
HTLGHGFVPDPIHAGGLRYHGMAPLISHVYELGFMEAMSIQQTECFEAALQFARTEGIIP
APEPTHAIAAAIREALECKRTGEEKVILIAMCGHGHFDLAAYDRYLRGDMVDLSHSSEKL
KESLAAIPKV
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgcttccatcgcgcttcaccctccacggctccaaggcccagggaaagctgca
ctccctcctcgcataccaaacaggagcagagtcactgtcagcggtacaaggagcttcgcc
accagagccggctcgaatccggggaacgtgagcatcccgaagcaatggtacaacctggtg
gccgacctgccggtgaagccgccgccgcagctgcacccgcagacgcaccagccgctgaaa
cccagcgacctgtcccctctcttccccgacgagctcatccgccaggagctcaccgaggag
cggttcgtcgacatcccggaagaggtccgcgacgtctacgagctctggcgccccacgccg
ctcatccgggccaaacgcctagagaaacttctcggcacgccggcgaagatctactacaag
tacgaaggcactagcccggcagggtcgcacaaggccaacacggccgtgccgcaggcgttc
tacaacgccgcggcgggggtgaagagcgtcgtcaccgagaccggcgccgggcagtggggc
agcgcgctctccttcgccagcacgctcttcggcctcacctgcgaggtctggcaggtgcgc
gcgtcctacgaccagaagccgtaccgaaggctgatgatggagacctggggagccaaggtg
cacccttcgccgtcggaggccacggagtccgggcggaagcttctcgcggcggacccgagc
agcccgggcagcctcggcatggcgatctcggaggcggtggaggtcgcggccaccaatggg
gacaccaagtactgcctcggcagcgtgctcaaccacgtgctgcttcaccagaccgtcatc
ggcgaggagtgcctggagcagctggccgccattggcgacacccctgacgtcgtcatcggc
tgcaccggcggcggctccaacttcggggggctcgcgttccccttcatgcgcgagaagctt
gctggcaggattaacccggtgttcaaggccgtcgagcccgcggcctgcccgacgctcacc
aagggggtttatgcttatgactatggcgacacggccgggctcacgccgctcatgaagatg
cacacgcttgggcatggctttgtccccgatcccatccacgcaggtgggcttcgttaccat
ggaatggcacctctgatctctcatgtgtatgagcttgggttcatggaagctatgtccata
cagcaaaccgaatgcttcgaagctgccttgcaatttgcgcggacggaggggatcatcccg
gcgccggagccgacgcacgccatcgcggcggcgatcagagaagcgctggagtgcaagaga
acaggggaggagaaggtcatcctcattgcgatgtgcggccacggccacttcgacctcgcc
gcctacgaccggtacctgagaggcgacatggttgatctgtcgcactcctccgagaagctg
aaggagtcgctagccgccattcccaaggtctga

DBGET integrated database retrieval system