KEGG   Brachypodium distachyon: 100845202Help
Entry
100845202         CDS       T01717                                 

Definition
(RefSeq) 3-hydroxyisobutyryl-CoA hydrolase 1
  KO
K05605  3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00280  Valine, leucine and isoleucine degradation
bdi00410  beta-Alanine metabolism
bdi00640  Propanoate metabolism
bdi01100  Metabolic pathways
bdi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100845202
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100845202
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100845202
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     100845202
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-GeneID: 100845202
NCBI-ProteinID: XP_010235022
UniProt: I1I6D4
Position
3
AA seq 381 aa AA seqDB search
MASPASSASDQVLVEANGSTRTLILNRPRQLNALSSAMVTGLLRCFNSYEEENAVKLLIV
KGKGRAFCAGGDVAEVAQSVNNDTWKYGADFFRTEFLLNYIIATYSKPQVSLLTGIVMGG
GAGVSIHGRFRVATENTVFAMPETALGLFPDIGASYFLSRLPGFYGEYVGLTGARLDGAE
MLACGLATHFVHLNRMSLLEESLKKMDTSDPFEICGIIDQFSQQPSIKESSTLNRLEIIN
KCFSKRTVEEIVSALEQEAASATDEWVTAAIRSLRKASPTSLKISLASIREGRLQTVGEC
LRREYRMVCHVMRGDFSRDFFEGCRAILVDKDRNPKWMPPSLDQVHDGVVEKYFSKVDDP
QWEDLNLPARRFQGRRIVPKL
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgccggccagcagcgcctccgatcaggtactggtggaagcaaatggctctaca
cggacattgattttgaataggccaaggcagttgaatgccctctcctctgcaatggttaca
ggacttctgaggtgtttcaattcttatgaggaagaaaatgcagttaaactgttgattgtg
aagggtaaagggagagcattttgtgctggaggtgatgttgctgaagttgcccagtctgta
aataacgatacctggaaatatggtgctgattttttccgaactgaatttttgttaaactat
atcattgcaacttatagcaaaccacaggtttctctacttactggaattgtcatgggagga
ggtgctggtgtttctatacatggaaggtttcgtgttgccacagagaacacggtttttgca
atgccagaaacagcattgggactctttccagatataggggcttcttattttctttctaga
ctacctgggttctatggagaatatgttggccttactggtgcaaggttagatggtgcggaa
atgcttgcatgtggcctggcaactcattttgtccatttgaataggatgtcactgcttgaa
gaatcgcttaaaaagatggacacttctgacccgtttgaaatatgtggaattatcgatcaa
ttttcacaacagccatccataaaagaaagcagtactctgaatagactggaaatcatcaac
aaatgcttttcgaaaagaacagtcgaagaaatcgtatctgctcttgaacaagaagctgca
agtgcgactgatgaatgggtaactgctgcaatccgatcattgcggaaggcttctccaact
agtctgaaaatctctctcgcatcgataagagaaggaagactgcaaactgttggcgaatgc
ttgcgccgagaatatagaatggtttgccatgtgatgcgtggtgactttagcagagacttc
tttgagggatgcagggctatattagttgataaagatcgaaacccaaagtggatgcctcca
agtttggatcaagtgcacgatggggttgttgaaaaatatttctccaaggttgatgaccca
cagtgggaagatttgaacctacccgccagacgttttcaagggagaagaattgttcccaag
ctttga

DBGET integrated database retrieval system