KEGG   Brachypodium distachyon: 100845254Help
Entry
100845254         CDS       T01717                                 

Definition
(RefSeq) beta-fructofuranosidase 1
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00052  Galactose metabolism
bdi00500  Starch and sucrose metabolism
bdi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bdi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100845254
   00500 Starch and sucrose metabolism
    100845254
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     100845254
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 100845254
NCBI-ProteinID: XP_003580229
UniProt: I1J037
Position
5
AA seq 679 aa AA seqDB search
MIPAVSAFMDDDDAGIGVHDDPAAGESTHAPLLPETSLQGRRAPARQKPQPSSSSVLPAI
AWTAVLLLALAGLVSYGRPQQRHGGVADPMEDDEVAGAGLAVEVAASRGVVQGVSEKSAG
PALLEAGRAFDWTKGMLAWQRTAFHFQPQKNWMNDPNGPLYYKGWYHLFYQWNPDAAVWG
NITWGHAVSRDLIHWLHLPLAMVPDHWYDINGVWTGSATTLPDGRIVMLYTGATEEMVQV
QLLAEPADPSDPLLLRWAKSEANPILVPPPGVGLSDFRDPTTAWLNPTDSTWRITIGSKN
PEHAGLALVYKTTDFVHYDLLPSLLHLVHGTGMWECVDFYPVSTTSRPGGEIGLETSVPP
GPGVKHVVKVSLDDDRNDYYAIGTYDAKDDTWTPDDAAIDVGIGLRYDYGRFYASKTFYD
PVGRRRVLWGWIVETDSERADILKGWAGLQSVPRTVLMDTKTGSNLLQWPVVEVENLRMR
GKSFDGLAVPPGSVVPLDVGKASQLDIEAAFQVHLDSSVAGGAEGAESYNCSASAGAAGR
GVLGPFGLLVLADEGLSEQTAVYFYLVKDANGKFTTFFCQDALRSSKANDLDKKVYGSLV
PVLDGENLSVRILVDHSIVESFAQGGRTCITSRAYPTKAIYDSARVFLFNNATNVNITAK
SLKIWEMNSAYIRPYPSSV
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgatcccggcagtctcagcgttcatggacgacgacgacgccggcatcggcgtccacgac
gaccccgcggccggcgagagcacgcacgcgccgctgcttccggagaccagccttcagggc
cggcgtgcccccgcgaggcagaagccgcagccgtcgtcgtcgagcgtgctcccggccatc
gcgtggacggccgtgctcctgctcgcgctcgcggggctcgtgtcctacggcaggccgcaa
caacgccatggcggcgtcgctgatccaatggaggacgacgaggtcgcaggcgcgggcctc
gcggtggaggttgccgcgtcccggggcgtcgtgcagggcgtgtcggagaagtccgccggc
ccggcgctcctcgaggccgggcgcgccttcgactggaccaaggggatgctggcgtggcag
cgcacggcgttccatttccagccccagaagaactggatgaatgatcccaacggtccattg
tactacaagggatggtaccatctgttctaccaatggaacccggacgcggcggtgtggggg
aacatcacgtggggccacgccgtgtcgcgcgacctcatccactggctgcacctgccgctg
gccatggtgcccgaccactggtacgacatcaacggcgtctggaccggctccgccacgacg
ctcccggacggcaggatcgtcatgctctacacgggcgccacggaggagatggtccaggtg
cagctcctggccgagccggccgacccgtccgacccgctgctgcttcggtgggccaagtcg
gaggcgaacccgatcctggtgccgccgccgggcgtcgggctcagcgacttccgcgacccg
accacggcgtggctcaacccgaccgactccacgtggcggatcaccatcgggtccaagaac
ccggagcacgccgggctggcgctggtgtacaagacgacggacttcgtgcactacgacctg
ctgccgtcgctgctgcacctggtgcacggcacggggatgtgggagtgcgtggacttctac
ccggtgtccaccaccagcaggccgggcggcgagatcgggctcgagacgtccgtgccgccg
gggcctggggtgaagcacgtggtcaaggtcagcctcgacgacgacaggaacgactactac
gccatcggcacctacgacgccaaggacgacacatggacgccggacgacgccgccatcgac
gtcgggatcgggctccggtacgactacggcaggttctacgcctccaagaccttctacgac
cccgtcggccgccggcgcgtgctctgggggtggatcgtcgagaccgatagcgagcgtgca
gacatcctcaagggctgggcaggcctccagtcagttccgaggacggttctcatggacacg
aagacaggcagcaacctgctccagtggccggtggtggaggtggagaacctccggatgcgc
ggcaagagcttcgacggcctggccgtgccgcccggctccgtcgtgcccttggacgtcggc
aaagcatcacagttggacatcgaagcggcctttcaggtacatctggactcgtcggtggcc
gggggagcggagggggcagaatcgtacaactgcagcgcgagcgccggcgcggcggggcga
ggcgtgctcggcccgttcgggctcctcgtgctggccgacgagggcttgtcggagcagacc
gccgtctacttctacctggtcaaggatgccaacggaaaattcaccactttcttctgccaa
gatgcgctcaggtcgtcaaaggcgaacgatctcgataagaaagtatacggcagcttggtc
cctgtacttgatggagaaaatctgtcagtaagaatactggttgatcactccatagtggaa
agctttgctcagggcgggaggacttgcattacatcgcgcgcctaccctacaaaggcgatc
tatgactctgccagagtcttcctcttcaacaacgcgacaaatgttaacatcaccgcgaaa
tcactcaagatctgggagatgaactcagcttacatccgtccatatccaagttctgtctaa

DBGET integrated database retrieval system