KEGG   Brachypodium distachyon: 100845304Help
Entry
100845304         CDS       T01717                                 

Definition
(RefSeq) guanine nucleotide exchange factor SPIKE 1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
bdi  Brachypodium distachyon
Brite
KEGG Orthology (KO) [BR:bdi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bdi04131]
    100845304
Membrane trafficking [BR:bdi04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    100845304
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2
Motif
Other DBs
NCBI-GeneID: 100845304
NCBI-ProteinID: XP_010234924
UniProt: A0A0Q3FEA1
Position
3
AA seq 1843 aa AA seqDB search
MSAADLVVADATAREWQRFKLIPRVSCAGNLDLDPLLNENLEQWPHLNELVQCYKADFVK
DDCKYGRYDSVAPPSFRSQIFEGPDTDIETELQLCNARHSKPEETTEDDMPSTSGRQIYE
TEPCASSSNKPCSLSPLPAYEPAFDWNNERSLIFGQRVTESLPATHISGLKITVKVLSLS
LEAGLVEPFGGTICLYNRDRREKLSEDFCFRILPTEMQDAHISLDRWSVFSLDAPSPSVC
LLIQLEKAATEEGGVTPSVYSRKEPVHLTEKEKQKLQIWSRIIPYKEPFAWAMIPLFENN
HAGGVGDAVSPSSPLAPSISGSSSQDSIVEPTSKLALEGKLNHYSSGSSVIVDISNLNKV
KESYIEDSLQDPKRKVHKPVKGVLRLEVEKLHNDRNDTDTISEGGSMNNELHGAELNNGR
HHRNSFDGAHSYLNSSAVVQKNARQNGQNSNAENGDNFQAFDFRMMTRSEPFSQLFHCLY
VYPLTVSLSRKRNLFVRVELRKDDADIRKLPLEAIHPRDWSTTLQKFVHTQISVGTRMSC
FHDEVKISLPALLTPQHHLLFTFFHVDLQMKLEAPKPVIVGYAALPLSTHIQLLSDVSLP
ILRELVPHYLQESGKERMEYLEDGKAVFRLRLRLCSSLFPVNERIRDFFVEYDRHTLHTS
PPWGSELLEAINSLKNVESTALLQFLHPILNMLLRLIGDGGETLQVAAFRAMVNILTRVQ
QESSDGAERNRFLVNYVDFAFDDFGDRQTPVYPGLSTVWGSLARSKAKGYRVGPVYDDVL
AMAWFFLELIVKSMGLEQSHLFYHNLPQGEDVPPLQLKEGVFRCIMQLFDCLLTEVHERC
KKGLNLAKRLNSTLAFFCYDLLSIIEPRQVFELVSLYMDKFAGVCQSVLHDCKLTFLQII
CDHDLFVEMPGRDPSDRNYLSSVLIQEIFLTLDHDDLLQRAKAARILVVLISKHEFDTRY
QKSEDRLYIAQLYFPLIGQILDEMPVFYNLNAVEKREVLVLILQIIRNLDDTTLLKAWQQ
SIARTRLFFKLLEECITHFEHSRAGDSLLLGSSSRSPDAERPVSPKYSDRLSPSVNAYLS
DASRHEIRLQGTPENGYMWNRVIPQLSSPNQPYSLREALAQAQSSRIGSTARALRESLHP
VLRQKLELWEENLSTAVSLEVLGIIEKFSVAAASRSISTDYTKLDCVTSILMGLLSRSQP
LTFWEAFLPVVYNIFSLHGATLMARENDRFLKQIAFHLLRLAVFRNDSVRKRAVVGLQIL
VRNSFNYFKSTTRLRVMLTITLSELLSDVQVTQMKSDGSLEESGEARRLRKSLEEMADVR
SKDQLNECGLPVNALEVSAEGSTDNRWSWVEVKHLSKCLVQALDAGLEHALLGSVTTLDR
CAAAEGFYKLALAYAPVPDLHIMWLLHLCDAHQEMQSWAEAAQCAVAVAGVIMQALVGRN
DAVWSREHVASLCRICPIVGTDVGAEVSAAEVEGYGASKLTVDSAVKYLQLANKLFAQAE
LYHFCASIQELIIPVYKSRRAYGQLAKCHKSLTNIYESILEQEASPIPFIDATYYRVGFY
GDRFGKLNKKEYVFREPRDVRLGDIMEKLSHTYEAKMDGNQNLHIIPDSRQVNADELQPG
VCYLQITAVDPVMEDEDLESRRERIFSLSTGTVRARVFDRFLFDTPFTKNGKTQGGLESQ
WKRRTVLQTEGSFPALVNRLLVIKSESLEFSPVENAIGMIETRTAALRNELEEPRSSEGD
QLPRLQSLQRILQGSVAVQVNSGVLSVCTAFLSGEPATRLRSQELQQLIAALLEFMAVCK
RAIRVHFRLIGEEDQEFHTQLVNGFQSLTAELSHYIPAILSEL
NT seq 5532 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcagcggatctggtggtggcggacgcaacagcgagggaatggcagcggttcaag
ttgattccaagggtgtcgtgtgctgggaacctggacctggatccactgcttaatgaaaat
ttagagcaatggccacatctaaatgagttggtacagtgctataaggctgattttgttaaa
gatgactgcaaatacggacgatatgatagtgtcgcaccaccgtcctttagaagtcaaatt
tttgagggacctgataccgacatagaaacagaattgcagctttgcaacgctaggcattcc
aagcccgaggaaactactgaagatgatatgccaagcacctcagggaggcaaatatatgag
actgaaccgtgtgcttcatcttcaaacaaaccctgtagtctctcacctttaccggcatac
gaacctgcatttgattggaacaacgagagatctttgatatttggccaacgggtgacagaa
agtctccctgcaacacacatcagtggattgaagataactgtgaaggtgttatctttgtca
ttagaagctggattggtagaaccttttggcggtacaatctgcttgtacaacagagataga
agagaaaaactatctgaagacttctgtttccgcatacttccaacagaaatgcaagatgct
catatttctttggaccgttggagtgttttttcgttggatgccccttcaccatcagtctgc
cttctgatccagcttgaaaaagctgctactgaagaagggggagtaactccttccgtttat
tcccgcaaagaacccgtgcacttgactgagaaagagaagcagaagctgcaaatttggtct
cgaatcattccatataaagagccatttgcatgggcaatgattcctctgtttgaaaacaac
catgctggtggtgtgggtgatgctgtgtctcctagcagccctttagcaccaagtatttca
ggctcaagttctcaagatagcatcgtggagcctacttccaagctcgctttggagggaaaa
ctcaaccattattcaagtggaagctcggttattgtagatatatcaaacttaaacaaagtg
aaggaaagctacatagaggactccctccaggatccgaaacggaaagtacacaaaccagtt
aaaggtgtactgaggctagaggtggaaaaacttcataatgaccgtaatgatacagatacc
atttctgaaggcgggagcatgaacaatgagttgcatggtgctgaactcaacaatggcaga
catcacaggaatagctttgatggggcccacagttatctgaattctagtgctgttgtccag
aaaaatgcacgccagaatggtcaaaattccaatgcagagaatggtgacaattttcaagct
tttgactttcggatgatgactcgaagcgaaccattttctcaacttttccattgcctctat
gtgtacccattgaccgtcagcttgagccgcaagagaaatctattcgtaagagtagaattg
agaaaggatgatgctgacatccgtaaacttccactggaggctattcatccaagggattgg
agtacaacgctacagaagtttgtccatacgcagatttctgttggcacgagaatgtcttgc
ttccatgatgaagtgaagatcagtctgcctgctctattgactccccaacatcatcttctg
ttcacattcttccatgtagatctccaaatgaaacttgaagcccctaaaccagtgattgtg
ggatatgccgcacttccactgtcgacacacattcagttactttcagatgtatctttgcca
attttacgagagcttgttccgcattacctgcaggaaagtggaaaggagagaatggaatac
ctagaggatggaaaagctgttttcagactgcggttaagactttgctcttcgttgtttcca
gttaatgaaaggataagagacttttttgtcgagtatgaccgccacacactacatacaagt
ccaccttggggctctgagcttcttgaggccataaatagtttgaagaatgttgaatctact
gcattgttacaatttcttcacccaatactcaacatgctgctgcgtcttattggtgatggt
ggtgaaacacttcaggttgctgcatttcgagccatggttaatattctaacccgggttcaa
caggaatcatctgatggggctgagagaaataggtttcttgttaattatgttgattttgct
tttgatgactttggtgatcggcaaacacctgtataccctggtttatctactgtttggggt
agcctagctcggagtaaggctaaaggttatagagttgggcccgtctatgatgatgtgttg
gcaatggcttggttttttctggagcttattgtaaaatcaatgggattggagcaaagtcat
ctcttctaccacaatcttccacaaggtgaagatgtcccaccgctacagttgaaagaaggt
gtattcagatgtatcatgcagctgtttgattgccttttaactgaggttcatgaacgctgt
aaaaagggtttaaatttggcaaagcgcttgaacagcactcttgctttcttttgttatgat
cttttatcaatcatcgagccacgccaagtttttgagctggtgtcgttgtatatggacaag
tttgcaggggtttgtcaatcagttctccatgattgcaaattgacattcctgcagataata
tgtgatcacgatctttttgttgagatgcctggccgggacccctctgataggaattatctc
tcgtctgtccttatccaggagatctttctcacccttgaccatgatgatttattacagcga
gcaaaagcggctcgtattttggttgtcctgataagcaagcatgaatttgacacacggtat
caaaaaagtgaagacaggctgtacattgctcagctgtatttccctcttataggacagatt
ctagatgagatgcctgtgttctataatctaaatgctgttgaaaagcgtgaagttctagtg
ctcattttgcaaatcataaggaacttggatgacacaactcttctaaaagcgtggcaacag
agcattgctagaaccagactgttcttcaagctacttgaagaatgtataacccattttgag
cacagtagagcaggagatagtttgctgctaggctctagttctcggagtcctgatgctgag
cgccctgtgtcccccaagtattctgatcgattatccccatcggttaacgcatacttgtcc
gatgcttcacgccatgaaataaggcttcagggaacaccagaaaatggatacatgtggaac
agggttattcctcaactaagttccccaaatcaaccctattcattgagggaagcacttgct
caagcacaatcttcaagaattggatcaacagccagggcattgagagagtctctacatcca
gtactgagacagaagttggaactctgggaagaaaatcttagtaccgctgtgagccttgaa
gtattgggaataattgagaagttttcggttgctgcagcttctcgtagcatctctactgat
tacactaagctagattgtgtgacatctatcttaatgggtcttttgtctaggagccagccc
ttaactttttgggaagcttttcttcctgtggtctataatatattcagtcttcatggtgca
acactgatggcacgggagaatgaccgcttcttgaagcaaattgcttttcatcttttacga
cttgctgtattccgaaatgattctgttagaaaaagggccgttgttggattgcagatcctt
gttaggaactcattcaactatttcaagagcaccacaaggttgagggtcatgttgactatt
actttgtcagaattgctgtctgatgtgcaagtaactcagatgaaatctgatggttctctt
gaagaaagtggtgaagctcggcgtcttagaaaatcactagaggaaatggctgatgtcaga
agtaaggatcagttgaacgaatgtgggctccctgttaatgcactggaggtgtctgctgaa
ggttccacggacaacaggtggtcttgggtagaagttaaacatctatcaaaatgtctagtc
caggcccttgatgctggccttgaacatgcccttttgggttctgtaacaactctggacagg
tgtgcagctgctgagggtttctataagctagcattggcctatgcacctgttcccgatctt
catattatgtggttactgcacctatgtgacgcccaccaggagatgcaatcatgggctgaa
gctgcgcaatgtgcagttgctgtagctggtgtgatcatgcaggcacttgttggaaggaat
gatgctgtgtggagcagggagcatgttgcttccctgtgtaggatctgtcctattgtcggc
actgatgtgggtgcagaagtatctgcagcagaagtggagggatatggtgcatccaagctt
actgtggattcagctgtgaagtatcttcaacttgccaacaagctcttcgcacaggctgaa
ctataccatttttgtgctagcattcaggaactcataattcctgtgtacaagagcagaagg
gcttatgggcaactggctaagtgccataagtcgctcacgaacatctatgagtcaattctt
gagcaggaggctagccctattccattcattgatgccacatactacagagttggattttat
ggggatcgatttggcaagctcaataaaaaggagtatgtgtttagagagccacgggatgtt
cgtctgggtgacatcatggagaagcttagtcacacctatgaggctaagatggatggcaat
cagaatttacacataattcctgactcgagacaagtcaatgccgatgagctgcaacctggt
gtctgctatctgcagataactgctgttgatcctgtaatggaggacgaggacttggagagt
aggagggaaaggattttctctttatctactggcactgtgcgtgcacgcgtgtttgaccgt
ttccttttcgatacaccattcacaaagaatgggaaaacacaaggtggtctcgaatctcaa
tggaagagacgcacggtactccaaacagagggctcatttcctgctttggtaaatcgcctg
ctagtgatcaaatctgaatctctagaattttcgcctgttgagaatgcaattgggatgatt
gaaacaaggacagctgcattgagaaatgaactagaagaaccacgtagttctgaaggtgat
caactaccaagacttcaaagcctgcaaaggatactccaaggaagtgtagctgttcaggtc
aacagtggtgtattaagtgtttgcactgctttcttatctggagagcctgcaaccaggctc
agatctcaagaactacagcagctcatcgctgcactgcttgaattcatggctgtttgcaag
cgcgcgatccgtgtgcattttagattgataggggaagaagaccaggaattccacacgcaa
cttgtcaacgggtttcagtcgcttactgctgagctttcccactatattcctgctatactt
tcggagctatga

DBGET integrated database retrieval system