KEGG   Brachypodium distachyon: 112271623Help
Entry
112271623         CDS       T01717                                 

Definition
(RefSeq) aromatic-L-amino-acid decarboxylase-like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00350  Tyrosine metabolism
bdi00360  Phenylalanine metabolism
bdi00380  Tryptophan metabolism
bdi00950  Isoquinoline alkaloid biosynthesis
bdi00965  Betalain biosynthesis
bdi01100  Metabolic pathways
bdi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bdi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    112271623
   00360 Phenylalanine metabolism
    112271623
   00380 Tryptophan metabolism
    112271623
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    112271623
   00950 Isoquinoline alkaloid biosynthesis
    112271623
   00965 Betalain biosynthesis
    112271623
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bdi04147]
    112271623
Enzymes [BR:bdi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     112271623
    4.1.1.105  L-tryptophan decarboxylase
     112271623
Exosome [BR:bdi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112271623
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 112271623
NCBI-ProteinID: XP_024317101
Position
3
AA seq 510 aa AA seqDB search
MGSIDTNPTAFSAFPDDDKSFQPLNTDDVRAYLHKAVDFISDYYTNVESMPVLPNVKPGY
LQDQLSASPPTYSAPFDVTMKEIRNSVVPGMTHWASPNFFAFFPSTNSAAAIAGDLIASA
MNTVGFTWQAAPAATEMEVLALDWLAQLLRLPTTFMNRTSSGRGTGGGVILGTTSEAMLV
TLVAARDAALRRSGSVGVSGLPKLAVYAADQTHSTFFKACRLAGFDPANIRSIPTGPETD
YGLDPVRLLEIMQADVDAGLVPTYVCATVGTTSSNAVDPVGAVADVAAMFNAWVHVDAAY
AGSACICPEFRHHLDGVERVDSISMSPHKWLMTCLDCTCLYVRDAHRLSDALETNPEYLK
NDVTDSGEVTDLKDMQVGVGRRFRGLKLWMVMRTYGTAKLQEHIRSDVAMAKMFEDLVRA
DDRFEIVVPRNFALVCFRIKASGVMTEDDADEANRVLMENLNKTGKAYLAHTVVGDRFVL
RFAVGSSLQEERHVRSAWELIKKTTSEMMD
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcatcgacaccaaccccaccgccttctccgccttccccgacgacgacaagtcg
ttccagccgctcaacaccgatgatgtccgggcctatctccacaaggccgtggacttcatc
tccgattactacaccaacgtcgagtccatgcctgtcctccccaacgtcaagccggggtac
ctccaggaccagctcagcgcctctccgccgacctactcggccccttttgatgtcaccatg
aaggagatccgcaactccgttgtgcccggcatgacccactgggccagccccaatttcttc
gccttctttccgtcgacaaacagcgccgccgccatcgccggtgacctcatcgcctctgcc
atgaacaccgttgggttcacgtggcaggcggctccggccgcgacggagatggaggtgctc
gcgcttgactggctcgcgcagctcctccgcctgccgacgaccttcatgaaccgcacaagc
tccggccgtggcaccggtggtggtgttattcttgggacgaccagcgaggccatgctcgtc
acgcttgtcgctgcccgagacgccgccctacgccggagtggctctgttggcgtgtccggc
ctgcctaaattggcggtctatgctgccgaccaaacccactccacgttcttcaaggcgtgc
cgtctcgccggcttcgaccctgccaacatccgctccatccccaccgggccggagaccgac
tacggccttgacccggtgaggcttcttgagatcatgcaggccgatgtcgatgctggtctc
gtgccaacatatgtttgtgccaccgtcggcaccacctcctccaacgccgtcgaccccgtg
ggtgccgttgccgatgttgccgccatgttcaacgcatgggtccatgtcgatgctgcgtac
gccggcagcgcatgcatctgcccggagttccgacaccatcttgatggtgtcgagcgtgtg
gactccatcagcatgagcccacacaagtggctgatgacgtgtctagactgcacatgcctc
tatgtccgtgatgctcaccgactgagtgacgcgctggagacgaaccccgagtacctcaag
aatgatgtcacggactctggggaggtcactgacctcaaggacatgcaggtcggtgtggga
cgacgtttccgtggtctcaagctctggatggtgatgcgcacctatggcactgccaagctc
caggagcacatccgcagcgacgtcgccatggcaaagatgtttgaggacctcgtccgcgcc
gatgaccggttcgagatcgtcgtcccaaggaactttgctctggtgtgcttcaggatcaag
gcaagtggagtcatgacagaggacgacgccgatgaggccaaccgcgttctcatggagaac
ctgaacaagaccggcaaggcttaccttgcgcacacggtggtcggcgacaggttcgtgctc
cggttcgccgtggggtcatcactgcaggaggagaggcacgtgaggagtgcatgggagctc
atcaagaagacaaccagcgagatgatggattaa

DBGET integrated database retrieval system