KEGG   Burkholderia dolosa: AK34_1220Help
Entry
AK34_1220         CDS       T03793                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bdl  Burkholderia dolosa
Pathway
bdl00071  Fatty acid degradation
bdl00072  Synthesis and degradation of ketone bodies
bdl00280  Valine, leucine and isoleucine degradation
bdl00310  Lysine degradation
bdl00362  Benzoate degradation
bdl00380  Tryptophan metabolism
bdl00620  Pyruvate metabolism
bdl00630  Glyoxylate and dicarboxylate metabolism
bdl00640  Propanoate metabolism
bdl00650  Butanoate metabolism
bdl00900  Terpenoid backbone biosynthesis
bdl01100  Metabolic pathways
bdl01110  Biosynthesis of secondary metabolites
bdl01120  Microbial metabolism in diverse environments
bdl01130  Biosynthesis of antibiotics
bdl01200  Carbon metabolism
bdl01212  Fatty acid metabolism
bdl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bdl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AK34_1220
   00630 Glyoxylate and dicarboxylate metabolism
    AK34_1220
   00640 Propanoate metabolism
    AK34_1220
   00650 Butanoate metabolism
    AK34_1220
  Lipid metabolism
   00071 Fatty acid degradation
    AK34_1220
   00072 Synthesis and degradation of ketone bodies
    AK34_1220
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AK34_1220
   00310 Lysine degradation
    AK34_1220
   00380 Tryptophan metabolism
    AK34_1220
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AK34_1220
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AK34_1220
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AK34_1220
Enzymes [BR:bdl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AK34_1220
Exosome [BR:bdl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AK34_1220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJY13057
UniProt: A2W9L6
Position
1:1315498..1316676
Genome map
AA seq 392 aa AA seqDB search
MTEAVIVSTARTPLAKSWRGAFNMTHGATLGGHVVAAALERAKLDPAQVEDVIVGCANPE
GATGGNIARQIALRAGLPVTVPGMTVNRFCSSGLQTVALAAQRIIAGEGDVYVAGGVESI
SCVQNEMNRHMAYEGWLLEHKPEIYWTMLQTAENVAKRYGIAKERQDEYGVQSQLKAAAA
QEAGRFRDEIVPITVRAGVADNATGRLFTKEVTVSADEGIRPDTTLDGVSKIRPALPGGV
ITAGNASQFSDGAAACVVMSAKRAQQEGLQPLGVFRGFAVAGCEPDEMGIGPVFAVPKLL
KQAGLSVDDIGLWELNEAFAVQVLYCRDTLGIPDERLNVNGGAIAVGHPYGVSGTRLTGH
ALIEGKRRGVKYAVVTMCIGGGQGAAGLFEIV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagccgtaatcgtatcgaccgcccgcacgccgctcgcgaagtcgtggcgcggc
gccttcaacatgacgcacggcgcgacgctcggcggccacgtggtcgccgcggcgctcgag
cgtgcgaagctcgaccccgcgcaggtcgaggacgtgatcgtcggctgcgcgaaccccgaa
ggcgcgaccggcggcaatatcgcgcggcagatcgcgttgcgcgccgggttgccggtcacc
gtgccggggatgacggtgaaccgcttctgctcgtccggcttgcagaccgtcgcgctcgcc
gcgcagcggatcatcgccggcgaaggcgacgtgtacgtcgcgggcggcgtcgagtcgatc
tcgtgcgtgcagaacgagatgaaccggcacatggcgtacgaaggctggctgctcgaacac
aagcccgaaatctactggacgatgctgcagacggccgagaacgtcgcgaagcgctacggg
atcgcgaaggagcggcaggacgagtacggcgtgcagtcgcagctgaaggctgcggccgcg
caagaagccggccgctttcgcgacgagatcgtgccgatcaccgtgcgtgccggcgtcgcg
gacaacgcgaccgggcggctgttcacgaaggaagtgacggtgtcggccgacgaaggcatt
cggcccgacacgaccctcgacggcgtatcgaagatccggccggcgctgcccggcggcgtg
atcaccgcgggcaacgcgagccagttctcggacggcgcggccgcgtgcgtggtgatgagc
gcgaagcgcgcgcagcaggaagggctgcagccgctcggcgtattccgcggcttcgcggtc
gcgggctgcgagcccgacgaaatgggaatcgggccggtgttcgcggtgccgaagctgctg
aagcaggcggggctgagcgtcgacgacatcgggttgtgggagctgaacgaagcgttcgcg
gtgcaggtgctgtactgccgcgacacgctcgggattcccgacgagcggctgaacgtgaac
ggcggcgcgatcgcggtcggtcatccgtacggcgtgtccggcacgcggctgaccggtcac
gcgctgatcgaaggcaagcggcgcggcgtgaaatacgcggtcgtgacgatgtgtatcggc
ggcggacagggcgcggccgggctgttcgaaatcgtctga

DBGET integrated database retrieval system