KEGG   Burkholderia dolosa: AK34_2611Help
Entry
AK34_2611         CDS       T03793                                 

Gene name
apaG
Definition
(GenBank) protein ApaG
  KO
K06195  ApaG protein
Organism
bdl  Burkholderia dolosa
Brite
KEGG Orthology (KO) [BR:bdl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    AK34_2611 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 HHH_2
Motif
Other DBs
NCBI-ProteinID: AJY11725
UniProt: A2WCZ5
Position
1:complement(2806023..2806397)
Genome map
AA seq 124 aa AA seqDB search
MSQYQFTVSVKTSYLPEQSDPDCRQYAFAYTLTIRNTGQVAAQLIARHWIITDSESHVQE
VKGLGVVGHQPLLQPGEQFEYTSWAVIATPVGTMRGAYFCVAEDGERFEAPVDEFALHMP
RTLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagtatcagttcaccgtttcggtgaaaaccagctatttgccggaacaatccgac
cccgattgccgtcaatacgcattcgcgtacacgctgacgatccgtaacaccggtcaagtg
gccgcgcagttgatcgcgcggcactggatcatcaccgacagcgagagtcacgtgcaggag
gtgaaggggctcggcgtcgtcgggcatcagccgctgctgcagcccggcgaacagttcgag
tacacgagctgggccgtgatcgcgacgccggtcggcacgatgcgcggcgcctatttctgc
gtggcggaggacggcgaacgtttcgaggcaccggtcgacgagttcgcgctgcacatgccg
cgcacgctgcattga

DBGET integrated database retrieval system