KEGG   Burkholderia dolosa: AK34_2859Help
Entry
AK34_2859         CDS       T03793                                 

Definition
(GenBank) arginase family protein
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bdl  Burkholderia dolosa
Pathway
bdl00220  Arginine biosynthesis
bdl00330  Arginine and proline metabolism
bdl01100  Metabolic pathways
bdl01110  Biosynthesis of secondary metabolites
bdl01130  Biosynthesis of antibiotics
bdl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bdl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    AK34_2859
   00330 Arginine and proline metabolism
    AK34_2859
Enzymes [BR:bdl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     AK34_2859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AJY13940
UniProt: A2W5W7
Position
1:complement(3063883..3064875)
Genome map
AA seq 330 aa AA seqDB search
MTTSTAASDLRLANASASDTSPIEWIAAPSSLGLRPNDAGREPETWRGADVLLATDVVAS
VRARIWRLPHPAYTFEPQPGTRIRNGVSIREFSLELAARVADVLGRHAFPIVVGGDCSVL
LGCLLGNRRAGGNGLIHVDGHSDFFHPGNYDTSQRLGSAAGMDLALATGRGEPLLTCWPD
LDGPLVDDRDACQLGERDAETDEFATAYGDIVHTAITRMTIQQMLARGATAVAAQVVDWL
RMRGLARAWLHVDLDVLDQAQLAAVDSPGSPGLDFDGLDALLGPLVASGRVAGIDFTIYD
PSLDPGCAHAERIATSIVRCATALPGVRCG
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgtcgaccgctgcatccgacctacggctcgcgaatgcatcagccagcgacacc
agtccgatcgaatggatcgccgcgccgagcagcctcggcctgcggcccaacgatgcaggc
cgcgagcccgaaacctggcgcggcgccgacgtcctgctggccaccgatgtcgtcgcgagt
gtccgcgcgcgcatctggcgcctgccgcatcccgcctatacgttcgagccgcagcccggc
acgcgcatccgcaacggcgtgtcgatccgcgagttctcgctcgaacttgccgcgcgcgtc
gccgatgtgctcggccggcacgcgtttccgatcgtcgtcggcggcgactgcagcgtgctg
ctcggctgcctgctcggcaaccggcgcgcgggcggcaacgggctgatccacgtcgacggg
cacagcgacttcttccatcccggcaactacgacacgtcgcagcggctcggctccgcggcg
gggatggatctggcgctggcgacggggcgcggcgagccgctgctgacatgctggccggat
ctcgacggcccgctcgtcgacgatcgcgacgcatgccagctcggcgagcgcgatgcggaa
acggacgagttcgcgaccgcgtacggcgatatcgtgcacacggcgatcacgcgcatgacg
atccagcagatgctcgcgcgcggggcgaccgcggtggccgcccaagtagtcgactggctg
cgcatgcgcggactcgcgcgcgcatggctgcacgtcgatctcgacgtgctcgatcaggcg
cagcttgctgccgtcgattcgccgggctcgccggggctcgacttcgacgggctcgatgcg
ttgctcggcccgctcgtcgcgtcgggccgcgtggcaggcatcgacttcacgatctacgat
ccttcgctcgatccgggctgcgcgcatgcggagcggatcgcgaccagcattgtgcggtgt
gcgaccgcgctgcccggcgtgcgctgcggctag

DBGET integrated database retrieval system