KEGG   Burkholderia dolosa: AK34_3218Help
Entry
AK34_3218         CDS       T03793                                 

Definition
(GenBank) beta-eliminating lyase family protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bdl  Burkholderia dolosa
Pathway
bdl00260  Glycine, serine and threonine metabolism
bdl01100  Metabolic pathways
bdl01110  Biosynthesis of secondary metabolites
bdl01120  Microbial metabolism in diverse environments
bdl01130  Biosynthesis of antibiotics
bdl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bdl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AK34_3218
Enzymes [BR:bdl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     AK34_3218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AJY10661
UniProt: A2WGV2
Position
2:66045..67058
Genome map
AA seq 337 aa AA seqDB search
MIDLRSDTVTRPSQAMLAAMTAAEVGDDVWGDDPTVLRLQAVTAERAGKEAGLFFPSGTQ
SNLAALMAHCERGDEYIVGQLAHTYKYEGGGAAVLGSIQPQPIENAPDGTLPIAKIAAAI
KPIDNHFARTRLLALENTIGGQVLPEGYVQEAVAFARSRGLSAHLDGARVCNAAVASGRT
IAELSAPFDTVSICFSKGLGAPVGSVLVGSRALIERAQRWRKVLGGGMRQSGILAAACLY
ALDHNVERLADDHANAARLAEGLARIEPVKVLSHATNMVFAQFPEADCAPLEAWLKARGI
LTQMLYASRFVTHCDVSRADVDTFVDAVGAYFAQRRA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatttacgcagcgataccgtgacacgtccgagccaggcgatgctggccgcgatg
acagccgccgaagtcggcgacgacgtatggggcgacgacccgaccgtgctgcggctgcag
gcggtcacggccgagcgggcgggcaaggaggccggcctgttcttcccgagcggcacgcag
agcaatctcgccgcgctgatggcgcattgcgagcgcggcgacgaatacatcgtcggccag
ctcgcgcatacctacaagtacgaaggcggcggcgcggcggtgctcggcagcatccagccg
cagccgatcgagaacgcgccggacggcacgctgccgatcgcgaagatcgccgcggcgatc
aagccgatcgacaaccacttcgcgcgcacgcggctgctcgcgctcgagaacacgatcggc
ggccaggtgctgccggaaggctacgtgcaggaagccgtcgcgttcgcacgcagccgcggg
ctgtccgcgcacctggacggcgcgcgcgtgtgcaacgcggcggtcgcgtcgggccgcacg
atcgcggaactgagcgcaccgttcgacacggtgtcgatctgcttctccaaaggcctcggc
gcgccggtcggctcggtgctggtcggcagccgcgcgctgatcgagcgcgcgcagcgctgg
cgcaaggtgctcggcggcgggatgcggcaatcgggcattctcgcggctgcgtgcctgtat
gcgctcgaccacaacgtcgagcggctcgccgacgatcacgcgaacgccgcgcgtctcgcg
gaaggcctcgcgcgcatcgagccggtgaaggtgctgtcccacgcgacgaacatggtattc
gcgcagttccccgaagccgactgcgcgccgctcgaggcgtggctcaaggcgcgcggaatc
ctcacgcagatgctgtacgcgtcgcgcttcgtcacgcactgcgacgtgtcgcgcgcggac
gtcgatacgttcgtcgatgcagtcggcgcgtatttcgcgcagcggcgcgcgtaa

DBGET integrated database retrieval system