KEGG   Burkholderia dolosa: AK34_3632Help
Entry
AK34_3632         CDS       T03793                                 

Gene name
uppS
Definition
(GenBank) di-trans,poly-cis-decaprenylcistransferase
  KO
K12503  short-chain Z-isoprenyl diphosphate synthase [EC:2.5.1.68]
Organism
bdl  Burkholderia dolosa
Pathway
bdl00900  Terpenoid backbone biosynthesis
bdl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bdl00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AK34_3632 (uppS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:bdl01006]
    AK34_3632 (uppS)
Enzymes [BR:bdl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.68  (2Z,6E)-farnesyl diphosphate synthase
     AK34_3632 (uppS)
Prenyltransferases [BR:bdl01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   AK34_3632 (uppS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Prenyltransf HET-S
Motif
Other DBs
NCBI-ProteinID: AJY09139
UniProt: A0A0D5ISF2
Position
2:complement(519576..520334)
Genome map
AA seq 252 aa AA seqDB search
MTQDLILRVPDTVAVESAAASQPVPTHVAVILDGNRRWAERCGVSIADGYRAGGRNVHAL
LSWCEEAGIPFVTLWPLSTENLSRDAAELGGLLAVIADVFDELAASGRSRLHVIGDLTKL
PAATAARIRAAEQRTTHAHGLDVTVAVAYSGRLDLLHAIRTLIEEHVAAGTVDRLPAQLS
AESIASRLYTAGQPEPDLVIRTSGEQRLSNFMLWQTAFSEFYFSPVCWPDFGRDDFERAI
DAYGKRARRFGR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagatttgattctgcgcgtgcccgacaccgttgcagtcgaatcggcggccgcg
tcgcaaccggtgcccacgcacgttgccgtgatactcgacggcaatcggcgctgggccgag
cggtgcggcgtatcgatcgccgacggctatcgggcgggtgggcgcaacgtgcacgcattg
ctgtcgtggtgcgaagaagccggcataccgttcgtcacgctgtggccgctgtcgaccgaa
aacctgagtcgcgacgccgcggagctcggcggattgctggccgtgatcgccgacgtattc
gacgaactcgcggcaagcgggcgctcgcgcctgcacgtgatcggggatctgacgaagctg
ccggcggcgacggccgcacgcatccgcgcggccgaacagcgcacgacgcacgcgcacggg
ctcgacgtgaccgtcgccgtggcctacagcggccggctcgatctgcttcatgcgatcagg
acgctgatcgaggagcacgtcgccgccggcaccgtcgaccggttgcccgcgcaactgagt
gccgagtcgatcgcgagccggctctatacggccggacagccggaacccgatctcgtgatc
cgcacgtccggcgaacagcgcctgtcgaacttcatgctgtggcaaaccgcgttctccgag
ttttatttctcgccggtctgctggccggacttcggccgcgacgatttcgaacgcgccatc
gatgcgtacggcaagcgcgcgcgccgattcggcaggtag

DBGET integrated database retrieval system