KEGG   Burkholderia dolosa: AK34_3888Help
Entry
AK34_3888         CDS       T03793                                 

Definition
(GenBank) zinc-binding dehydrogenase family protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bdl  Burkholderia dolosa
Pathway
bdl00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bdl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AK34_3888
Enzymes [BR:bdl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AK34_3888
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AK34_3888
    1.1.1.-  
     AK34_3888
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C DAO
Motif
Other DBs
NCBI-ProteinID: AJY10901
UniProt: A2WF89
Position
2:complement(820766..821830)
Genome map
AA seq 354 aa AA seqDB search
MKAAVWRGRRDIRVEEVPVPDQPPPGWVKIRVHWCGICGSDLHEYVAGPVFIPVDAPHPL
TGLKGQCILGHEFSGEIAELGAGVTGFAVGDRVTADACQHCGTCWYCRHGLYNICENLAF
TGLMNNGAFAEYVNVPAELLYRLPDDFPTEAGALIEPLAVGLHAVKKAGSIVGQTVVVVG
AGTIGLCTIMCAKAAGAGRVIALEMSAARKQKALEVGASIVIDPKTSDAIAEVNALTGGY
GADVSFECIGHTSTAKLAIDVIRKAGKSVMVGIFEEPAPFNFFDIVSTEKEVIGSLAYNG
EFADVIRFIADGRIDVQPLITGRIALGDIVTRGFEELVHHKDRNVKIIVQPVAA
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgccgtctggcgcggccgccgcgacatccgcgtcgaagaggttcccgttccc
gaccagccgccgccgggctgggtcaagatccgcgtgcactggtgcggaatctgcggctcc
gacctgcacgaatacgtggccggcccggtgttcattccggtcgatgcgccgcatccgctg
acgggcctgaaaggccaatgcatcctcggccacgagttcagcggcgaaatcgccgagctc
ggcgcgggcgtgacgggcttcgcggtcggcgaccgcgtgaccgccgacgcatgccagcat
tgcggcacttgctggtattgcaggcacggcctgtacaacatctgcgagaacctcgcgttc
accgggctgatgaacaacggcgcattcgccgaatacgtgaacgtgccggccgaactgctg
taccggctgcccgacgacttcccgaccgaggccggcgcgctgatcgaaccgctggcggtc
ggcctgcatgcggtgaagaaggccggcagcatcgtcgggcagacggtcgtcgtggtcggc
gcgggcacgatcggcctctgcacgatcatgtgcgcgaaggccgcgggcgccgggcgcgtg
atcgcgctcgagatgtcggctgcgcgcaagcagaaagcgctcgaggtcggcgcgagcatc
gtcatcgatccgaagacgtcggacgcgatcgccgaagtgaacgcattgaccggcggctac
ggcgccgacgtctcgttcgagtgcatcggccacacgtcgaccgcgaagctggcgatcgac
gtgatccgcaaggccggcaagtcggtgatggtcggcatcttcgaagagccggcgccgttc
aacttcttcgacatcgtgtcgacggagaaggaagtgatcggctcgctcgcgtacaacggc
gaattcgccgacgtgatccgcttcatcgcggacggccgcatcgacgtgcagccgctgatc
accggccgcatcgcgctcggcgacatcgtcacgcgcggcttcgaggagctggtccatcac
aaggaccgcaacgtgaagatcatcgtgcagccggtcgccgcgtag

DBGET integrated database retrieval system