KEGG   Burkholderia dolosa: AK34_4380Help
Entry
AK34_4380         CDS       T03793                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bdl  Burkholderia dolosa
Pathway
bdl00010  Glycolysis / Gluconeogenesis
bdl00053  Ascorbate and aldarate metabolism
bdl00071  Fatty acid degradation
bdl00280  Valine, leucine and isoleucine degradation
bdl00310  Lysine degradation
bdl00330  Arginine and proline metabolism
bdl00340  Histidine metabolism
bdl00380  Tryptophan metabolism
bdl00410  beta-Alanine metabolism
bdl00561  Glycerolipid metabolism
bdl00620  Pyruvate metabolism
bdl00625  Chloroalkane and chloroalkene degradation
bdl00903  Limonene and pinene degradation
bdl01100  Metabolic pathways
bdl01110  Biosynthesis of secondary metabolites
bdl01120  Microbial metabolism in diverse environments
bdl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bdl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AK34_4380
   00053 Ascorbate and aldarate metabolism
    AK34_4380
   00620 Pyruvate metabolism
    AK34_4380
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AK34_4380
   00561 Glycerolipid metabolism
    AK34_4380
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AK34_4380
   00310 Lysine degradation
    AK34_4380
   00330 Arginine and proline metabolism
    AK34_4380
   00340 Histidine metabolism
    AK34_4380
   00380 Tryptophan metabolism
    AK34_4380
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AK34_4380
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AK34_4380
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AK34_4380
Enzymes [BR:bdl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     AK34_4380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: AJY10371
UniProt: A2WE23
Position
2:1420042..1421490
Genome map
AA seq 482 aa AA seqDB search
MQFDHYIDNARVAPNTGARIDVVDPSTGEPFATIARGDAHDVQHAVSAARRAMGDTLNGP
WAKLSPVERSNLLFAYAAAVSRHADELAQLEARDTGKALNTARTDAAVLARYLQYYAGCV
DKLHGDTLPYTAGFTVLTVREPIGVTGHIIPWNYPMQIYGRSVGASLAAGNACVVKPAED
ASLSILRLAELAADVGFPAGTVNVVTGLGSEAGAALSANPGIGHISFTGSTGTGALVARA
AADRHCPTVLELGGKSPQLLFDDADLEQALPAIVNAIVQNAGQTCSAGSRLLVQRNVYER
VLDRLAQQFARLRSGPPSMNLEMGPLVNAAQHARVRAIVERAQADGIRVAARGTIAPGAS
GSGYYQEAVLFRDVPPDSELAQEEVFGPVLAAMPFDDEDAAIALANSTRYGLVAGVWTRD
GARALRLARKLQAGQVFINNYGAGGGVELPFGGVKASGYGREKGFEALLGFTALKTIAIR
HD
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgcaattcgatcactacatcgacaacgcccgcgtcgcgccgaataccggcgctcgaatc
gacgtcgtcgatccgagcaccggcgaaccgttcgcgacgatcgcgcgcggcgacgcgcac
gacgtgcagcacgccgtttcggcggcacggcgcgcgatgggcgacacgctgaacggccca
tgggcgaagctgtcgccggtcgagcgcagcaacctgctgttcgcgtacgcggcggccgta
tcgcggcatgcggacgagctcgcgcagctcgaggcgcgcgacaccggcaaggcgctgaat
accgcgcgcaccgatgccgcggtgctggcgcgctacctgcagtactacgccggatgcgtg
gacaagctgcacggcgacacgctgccgtataccgccgggttcacggtattgacggtgcgc
gaaccgatcggcgtgacgggccacatcattccgtggaattacccgatgcagatctacggc
cggtcggtcggcgcgtcgctcgcggccggcaacgcgtgcgtcgtcaaaccggccgaggac
gcgagcctgtcgattctccgcttggccgagctcgcggcggacgtcggctttccggcgggc
accgtcaatgtcgtcaccggactgggcagcgaagcgggcgcggcgctgtcggccaatccc
ggcatcggtcacatctcgtttaccgggtcgaccggcacgggcgcgctcgtcgcgcgcgcg
gcggccgaccgtcactgcccgacggtgctcgagctgggcggcaagtcgccgcaactgctg
ttcgacgatgccgacctcgaacaggcgctgcccgcgatcgtcaacgcgatcgtgcagaac
gcgggccagacgtgctcggccggcagccgtctgctcgtccagcgcaacgtctacgagcgc
gtgctcgatcggcttgcgcagcaatttgcgcgtctgcgctcggggccgccgtcgatgaac
ctggagatggggccgctcgtcaacgccgcgcagcatgcgcgggttcgggccatcgtcgag
cgcgcacaggcggacggcattcgcgtggcggcccgcggcacgatcgcgcccggcgcatcg
ggttcgggctactaccaggaagcggtgctgttccgcgacgtgccgcccgacagcgaactc
gcgcaggaagaggtattcggtcccgtgctcgcagcgatgccgttcgacgacgaagacgcg
gcgatcgcgctcgcgaacagcacgcggtacggcctcgtcgccggcgtgtggacccgcgac
ggcgcacgcgcgttgcggctcgcgcgcaagctgcaggccggacaggtcttcatcaacaac
tacggcgccggcggcggcgtggagctgccgttcggcggcgtgaaggccagcggctatggt
cgcgagaaaggcttcgaagcgctgctcggctttaccgcgctcaagacgattgcgattcgg
cacgattga

DBGET integrated database retrieval system