KEGG   Brevundimonas diminuta: EQG53_04580Help
Entry
EQG53_04580       CDS       T05851                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
bdm  Brevundimonas diminuta
Pathway
bdm00471  D-Glutamine and D-glutamate metabolism
bdm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bdm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    EQG53_04580
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bdm01011]
    EQG53_04580
Enzymes [BR:bdm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     EQG53_04580
Peptidoglycan biosynthesis and degradation proteins [BR:bdm01011]
 Precursor biosynthesis
  Racemase
   EQG53_04580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: QAT13694
UniProt: A0A410NUL3
Position
complement(905093..905956)
Genome map
AA seq 287 aa AA seqDB search
MAIGVFDSGVGGLTVHRELTTRFPTRDFIYLGDQAHAPYGGRSGEDIVELTRAGCERLFE
AGASVVVLACNTASAIALRRLQQTWIPGMREKLGRPVNVLGIIVPTIEAATGLPWSFEAE
RESRLEGEKKQAIDITGVFCTAATAMSRVYEIEIDKRRDDLAVFTEACPGLAGLIELGAP
PEELKVVVDDHVDALRRRIGRHPDKAILGCTHYEIVADLFAQALPPGVQVISQPAAVADS
LERYFDRHPEYDLGASARRDFLTTGTPGPQSDLVAQFWGAPLTFDPA
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggcgataggcgttttcgactccggcgtggggggcctgacggtccaccgcgaactcacg
acccgctttccgacgcgggacttcatctatctgggcgaccaggcccacgccccctatggc
ggacgcagcggcgaggacatcgtcgaactgacccgcgcgggatgcgaacgcctgttcgag
gcgggcgcctccgtggtcgtcctggcctgcaacacggcttcggccatcgcgctgcgtcgt
ctgcaacagacctggattccggggatgcgcgaaaagctgggccgaccggtcaacgtcctg
ggcatcatcgtcccgaccatcgaggcggccaccggcctgccctggtcgttcgaggccgag
cgcgaaagccgcctggagggcgagaagaagcaggcgatcgacatcaccggcgtcttctgc
accgccgccacggccatgagccgcgtctatgagatcgagatcgacaagcgccgcgacgac
ctggccgtcttcaccgaggcctgccccggcctggccggtctgatcgagctgggcgccccg
cccgaggagctgaaggtggtcgtcgacgaccacgtcgacgccctgcgccgccgcatcggc
cgccatccggacaaggccatcctgggctgcacccactatgagatcgtggccgacctgttc
gcccaggccctgccgcccggcgtccaggtcatcagccagcccgccgccgtggccgactct
ctggagcgctatttcgaccgccacccggaatacgatctgggcgcgtcggcgcgccgcgac
ttcttgaccacgggcacgcccggcccgcagtcggatctggtcgcccagttctggggcgcg
cccctgacgttcgatccggcctag

DBGET integrated database retrieval system