KEGG   Brevundimonas diminuta: EQG53_07955Help
Entry
EQG53_07955       CDS       T05851                                 

Definition
(GenBank) response regulator transcription factor
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
bdm  Brevundimonas diminuta
Pathway
bdm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bdm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EQG53_07955
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bdm02022]
    EQG53_07955
Two-component system [BR:bdm02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   EQG53_07955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C Thump_like
Motif
Other DBs
NCBI-ProteinID: QAT14306
UniProt: A0A246KAS5
Position
complement(1592161..1592898)
Genome map
AA seq 245 aa AA seqDB search
MSMIEPRANGRSGPIAPAGSGRHILVVDDDDRIRELLKEFLSREGYRVTGAAHAGAARRM
VELIEFDLIVLDVMMPGESGFDLTTWIRSQAALSKTPVLLLTAKGDPDDRIEGLSRGADD
YMSKPFDPRELSLRIEAILRRTGGKLMTPKEIRMGPAVFDMERLELTRDGELQRLTEAEA
QLLKTLAIHAHSPVERMTLSPDTADVTGRAVDVQVTRLRRKLEADPKNPRYLQTVRGVGY
MLAPD
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
gtgagcatgatcgagcctcgcgccaacggccggtccggccccatcgcgcccgccggcagc
ggacggcacatcctggtcgtcgacgacgacgaccgcatccgcgaactgctcaaggaattc
ctgagccgcgagggctatcgcgtcaccggcgccgcccacgcgggcgcggcgcggcgcatg
gtcgaactgattgagttcgatctgatcgttctggacgtgatgatgccgggcgaaagcggc
ttcgacctgaccacctggattcgcagccaggcggccctgtccaagacgccggtgctgctg
ctgacggccaagggcgacccggacgaccggatcgagggcctgtcgcgcggcgccgacgac
tatatgtccaagcccttcgacccgcgcgagctgtcgctgcggatcgaggccatcctgcgc
cgcaccggcggcaagctgatgacgcccaaggagatccgcatgggccccgccgtcttcgac
atggagcggctggagctgacgcgcgacggcgaactgcaacgcctgaccgaggccgaggcg
caactgctcaagaccctggccattcacgcccattcgccggtcgagcgcatgaccctgtcg
cccgacacggccgacgtgaccggccgcgccgtggacgtccaggtgacgcgcctgcgccgc
aagctggaggcggaccccaagaatccgcgctacctccagacggtgcgcggcgtcggctat
atgctggcgccggactga

DBGET integrated database retrieval system