KEGG   Brevundimonas diminuta: EQG53_13850Help
Entry
EQG53_13850       CDS       T05851                                 

Gene name
rfaD
Definition
(GenBank) ADP-glyceromanno-heptose 6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
bdm  Brevundimonas diminuta
Pathway
bdm00540  Lipopolysaccharide biosynthesis
bdm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bdm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    EQG53_13850 (rfaD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:bdm01005]
    EQG53_13850 (rfaD)
Enzymes [BR:bdm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     EQG53_13850 (rfaD)
Lipopolysaccharide biosynthesis proteins [BR:bdm01005]
 Unusual sugar
  EQG53_13850 (rfaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 KR adh_short Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: QAT16162
UniProt: A0A410P1U1
Position
complement(2799814..2800803)
Genome map
AA seq 329 aa AA seqDB search
MIVVTGGAGFIGSNIVARLCESGAWDVVVCDRLETADLAKWKNIAKHPIADLWAPEELFD
QLERHAERIEAVIHMGAISSTTEPDADLILRTNFSLSRDIWDWCAVRNVRMIYASSAATY
GDGEAGFEDRDDPESLNALRPLNAYGYSKYLFDQYAVRQANRDEAPPQWAGLKFFNVYGP
NEGHKGGMKSVVAQIWPKVQAGETVSLFRSHNPNYPDGGQLRDFVFVDDVVGIILWLLEN
EAVSGVFNAGSGQARSFADLARATFAAAGKEPSIAYSDMPEAIRDRYQYFTEASMDRIRA
LGYGGQSTPLEEGVRRYVQDFLAQPDPYR
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgatcgttgtgaccggcggcgcgggcttcatcggctccaacatcgtcgcccgcctgtgc
gagagcggcgcttgggacgtggtcgtctgtgaccggctggagacggccgacctcgccaag
tggaagaacatcgccaaacaccccatcgccgacctgtgggcgcccgaagagctgttcgac
cagctggagcgtcacgccgagcgcatcgaggcggtgattcacatgggcgccatctcctcg
acgaccgagccggacgccgacctgatcctgcgcaccaacttcagcctgtcgcgcgacatc
tgggactggtgcgcggtgcgtaacgtgcggatgatctacgcctcctcggcggccacctac
ggcgacggcgaggccgggttcgaggatcgcgacgatcctgagagcctgaatgcgctgcgc
ccgctaaacgcctatggctattcgaaatatctgttcgaccagtatgccgtgcgtcaggcc
aatcgcgacgaggcgccgccccagtgggccgggctgaagttcttcaacgtctatggcccg
aacgagggccacaagggcggcatgaagtcggtcgtcgcccagatctggcccaaggttcag
gcgggcgagacggtcagcctgttccgctcgcacaacccgaactatcccgacggcggccag
ctgcgcgacttcgtctttgtcgacgacgtggtcggcattatcctgtggctgctggagaac
gaggctgtctcgggcgtattcaacgccggatcgggtcaggcgcgttccttcgccgatctg
gcccgcgccaccttcgcggcggcgggcaaggagccgtccatcgcctatagcgacatgccc
gaggcgatccgcgatcgctatcagtacttcaccgaggccagcatggatcgcatccgcgcc
ctcggctacggcggccagtcgacgccgctggaggaaggcgtgcgccgttacgtccaggac
ttcctggcccagccggacccgtaccgctga

DBGET integrated database retrieval system