KEGG   Brevundimonas diminuta: EQG53_14485Help
Entry
EQG53_14485       CDS       T05851                                 

Definition
(GenBank) nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
bdm  Brevundimonas diminuta
Pathway
bdm00230  Purine metabolism
bdm00240  Pyrimidine metabolism
bdm01100  Metabolic pathways
bdm01110  Biosynthesis of secondary metabolites
bdm01130  Biosynthesis of antibiotics
Module
bdm_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
bdm_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
bdm_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:bdm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    EQG53_14485
   00240 Pyrimidine metabolism
    EQG53_14485
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bdm04131]
    EQG53_14485
Enzymes [BR:bdm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     EQG53_14485
Membrane trafficking [BR:bdm04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    EQG53_14485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: QAT15453
UniProt: A0A246KM72
Position
complement(2927066..2927485)
Genome map
AA seq 139 aa AA seqDB search
MTERTFSIIKPDATRRNLTGAINAVIEGAGLRIVGQRRVKLTEAQAKKFYEVHAERPFYG
ELVSQMIAEPVVVQVLEGDNAVAKYREVMGATNPNDAAEGTIRKLFALSIGENSVHGSDS
LENAGIEIAQFFTDADIVG
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacgtacgttctcgatcatcaagccggacgccacccgccgtaacctgacgggc
gccatcaacgccgtgatcgaaggcgccggcctgcgcatcgtcggccaacgccgcgtcaag
ctgaccgaagcccaagccaagaagttctacgaagtgcacgccgagcgtcccttctacggc
gaactggtctcgcagatgatcgccgagccggtcgtcgtccaggtgctggaaggcgacaac
gccgtcgccaaataccgcgaagtcatgggcgccaccaacccgaacgacgccgctgaaggc
accatccgcaagctgttcgccctgtcgatcggcgagaactcggtccacggttcggactcg
ctggagaacgccggcatcgagatcgcccagttcttcacggacgccgacatcgtcggctaa

DBGET integrated database retrieval system