KEGG   Bacteroides dorei HS1_L_1_B_010: EL88_09125Help
Entry
EL88_09125        CDS       T03262                                 

Definition
(GenBank) 2-amino-3-ketobutyrate CoA ligase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
bdo  Bacteroides dorei HS1_L_1_B_010
Pathway
bdo00780  Biotin metabolism
bdo01100  Metabolic pathways
Module
bdo_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:bdo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    EL88_09125
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bdo01007]
    EL88_09125
Enzymes [BR:bdo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     EL88_09125
Amino acid related enzymes [BR:bdo01007]
 Aminotransferase (transaminase)
  Class II
   EL88_09125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase Cys_Met_Meta_PP OKR_DC_1 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AII63327
UniProt: A0A076IRS7
Position
2072916..2074103
Genome map
AA seq 395 aa AA seqDB search
MGLLQDKLSKFRLPQLYMERGVYPYFREIDSHQDTEVIMDGKKVLMFGSNSYMGLTYDER
IIEAAIAATRKYGTGCAGSRFLNGTLDLHVQLEKELAEFVGKDDALVYSTGFTVNEGVVS
CLTDRNDYIICDDRDHASIVDGRRLSFSTQLKYKHNDMEALEKELQKCKPESVKLIVVDG
VFSMEGDLANLPEIVRLKDKYNASIMVDEAHGLGVFGRDGRGVCDHFGLTDQVDVIMGTF
SKSLASIGGFVAADKDTINWLRHNSRSYIFSASNTPAATAAARAALHILKSEPERRENLW
KITNYALDCFRQAGFEIGDTESPIIPLYVRDTDKTFEVTKLAFDEGIFINPVIPPACAPQ
DTLVRVALMATHTKEQVDYAVDKLTKCFKKLEIIK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgggattattacaagacaagttaagtaaattcagattgcctcaactatacatggaaaga
ggcgtttacccttattttcgtgagatagacagccatcaggatacagaggttatcatggat
ggtaaaaaggtgctgatgtttggctccaactcatatatggggttaacctacgatgaacgg
attatcgaagcagctattgctgcaacccgtaaatatggtacaggttgtgcaggttcacgc
ttcttgaatggtacgcttgatctgcacgttcagttagaaaaggaattggcggaattcgta
gggaaagatgatgcattggtttattctaccggttttactgtaaatgaaggtgtggtatct
tgcctgacagaccgcaatgactacattatctgcgatgaccgtgatcatgcttccatcgta
gacggacgtcgtctttctttctccacccagttgaaatacaagcacaatgatatggaagcc
cttgagaaagaacttcagaagtgtaaaccggaatctgtgaaactgattgtggtggatggg
gttttctctatggaaggtgatttggctaacttgcctgagattgttcgtttgaaagacaaa
tacaatgcaagtatcatggtggatgaagcacatggcttgggtgtgttcggtcgtgacggg
cgaggagtctgcgatcacttcggactgacagatcaggtagatgttattatgggtacattc
tcaaagtcactggcttctatcggtggttttgttgctgcggataaagatacaatcaactgg
ttgcgtcacaactcacgctcatatatattctctgcaagtaatactcctgctgcaacagct
gctgcacgtgctgcacttcatatccttaagagtgagcccgaacgtcgtgagaatttgtgg
aagattacaaattatgctttggattgtttccgtcaggccggttttgaaatcggtgatact
gaaagtccgatcattccactttatgttcgtgatacggacaagacattcgaagtgactaag
ctggcatttgacgagggtatatttattaatcctgttattccaccagcttgtgcaccacaa
gatactttggtgcgtgttgctttgatggctactcatacaaaggaacaagttgactatgct
gtggataaactgaccaagtgctttaagaagttggaaatcataaaataa

DBGET integrated database retrieval system