KEGG   Bdellovibrio sp. qaytius: CIK05_03475Help
Entry
CIK05_03475       CDS       T05880                                 

Definition
(GenBank) carbon-nitrogen hydrolase family protein
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
bdq  Bdellovibrio sp. qaytius
Brite
KEGG Orthology (KO) [BR:bdq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CIK05_03475
Enzymes [BR:bdq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     CIK05_03475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase Lys-AminoMut_A
Motif
Other DBs
NCBI-ProteinID: AZZ35892
UniProt: A0A3T0RP05
Position
678492..679328
Genome map
AA seq 278 aa AA seqDB search
MKITLLQLNSSDDISKNLERIVALVESHLAAQTQNPTQKKTRLFILPENSLYFRIIEGEP
LKALTLDSAEIQQLQRLADLHKIDLHFTTAISDGGKVWNASVLVSPGEPAKIIYKKIHLF
DIQLEGQKAIRESDFFTHGDEVTGFEIDGVRFGSSICYDLRFSELYQQLAKNKVDVILVP
AAFLVKTGQAHWETLLRARAIESQAYVLASAQVGEHKTTQAGKAASRFTYGHTMAIDPWG
QVVEIKAEGVGCLDIEISLDLVRSVRRQIPMSEHRRLK
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattactctgcttcagttaaattcttctgacgatatctctaaaaatttagagcgg
attgttgctcttgttgaatcgcatttagctgcgcaaactcaaaacccaacgcagaaaaaa
actcgtctatttatacttcctgaaaatagtctttattttagaattattgaaggtgagcct
ttaaaagctttaactttagattcggctgagattcagcagttgcaaagactagctgatttg
cacaagatagatctgcattttacgacagctatttctgatggtggtaaagtttggaatgcc
tctgtgctggtgagcccgggtgagcctgctaaaattatttataaaaaaattcatcttttt
gatattcagctcgaggggcagaaggccattcgtgaatctgatttttttactcacggagat
gaagtcactggctttgaaatagatggcgttcgttttggatcgtcgatttgttatgacctt
cgcttttctgaactttatcagcaattagctaaaaataaagtggatgtgatcttggtgccg
gctgcatttttggtaaaaactgggcaggctcactgggaaaccttactaagagcgcgcgct
attgagtcgcaagcctatgttttggcttcggctcaagttggtgagcataaaaccactcag
gccgggaaagccgcatctcgctttacttatgggcatactatggccattgatccttggggt
caggttgtagaaataaaagctgaaggtgtgggctgtttagatatagaaatcagtttagat
cttgttcgatcagtgcgtcgtcaaattcctatgagcgaacacagacgtcttaagtga

DBGET integrated database retrieval system