KEGG   Bdellovibrio sp. qaytius: CIK05_08990Help
Entry
CIK05_08990       CDS       T05880                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bdq  Bdellovibrio sp. qaytius
Pathway
bdq00450  Selenocompound metabolism
bdq00970  Aminoacyl-tRNA biosynthesis
bdq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bdq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CIK05_08990
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CIK05_08990
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bdq01007]
    CIK05_08990
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bdq03016]
    CIK05_08990
Enzymes [BR:bdq01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CIK05_08990
Amino acid related enzymes [BR:bdq01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CIK05_08990
Transfer RNA biogenesis [BR:bdq03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CIK05_08990
 Prokaryotic type
   Other AARSs
    CIK05_08990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AZZ36919
UniProt: A0A3T0RS81
Position
1862512..1864452
Genome map
AA seq 646 aa AA seqDB search
MSQDQKPQFVQPTDVKSVLAQFKKPKKVVVTAGMPYANGPLHLGHLAGAHVPADIYARWM
RMLIGAENVLFVNGNDDHGSTSEVAANKAGKTIREFIDTIHDQQKLTLKNYSIQTDVFTG
TSRPETYPLHEKYSQDFMRRLFKNDMLEKRITKQWFDPKANRFLQDRFVRGTCPNCQSTE
AYSDECDACGAKFNPSELKDPRSQLTDATPELKDTAHWWLNMWKVADPLKAWIDTKQKAW
RTGVVQEVTNTVLIGCRFENTHEPKYKEIKDTLPKHKSRYVPGKKVECLFDNKADLATAQ
STLEASGIPSTITDHWGHRPITRDVSNGIPVPPELDSEMKGKTLYVWPDSLIAPIVFSQV
ALKQSGRDPESYKDFWCDPEATVVQFLGQDNVFFYVIMQGSMWLGQQGNTQVAPAKGDLQ
MTEILSVFHLMVNGEKMSKSTGNFYSGDQLLEMGYSSEQVRYYLAMLSLPVKASNFDFAH
FAERNKFLAGPLNAALEKPVSACNGKFGGVVPEGKLIGKAEAETMKLVQMYLRSMQKGDY
STLLGQIENYARQINSLFTQFKPHDDRGVEADRKDALFTCFYVLKNLMIMLAPFAPETMN
EVRKTLNLPESVMVASELGTGIAAGHKIGEKRTYFPAVAGAETAAE
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaagatcaaaaaccacaattcgttcaaccgactgatgtaaaatcggttttagct
cagtttaaaaaaccaaaaaaagtggttgtgactgcaggtatgccttacgccaatggcccc
ttacatttaggtcacttagccggagcccatgtacctgctgatatttacgcccgttggatg
cgaatgcttattggcgctgagaatgttttattcgtgaacggcaatgatgatcatggttca
acttctgaggttgcggcaaacaaagctggtaaaacgattcgtgaatttattgataccatt
catgatcaacaaaaattaactttaaaaaattattcaattcaaacagatgtgttcacagga
acttcacgtcctgagacttacccgcttcatgaaaagtactcgcaagatttcatgcgtcgt
ttatttaaaaacgatatgttagaaaaacgaattactaaacaatggtttgatccaaaagcg
aatcgctttttacaagatcgttttgttcgcggcacttgcccgaattgtcaaagcactgaa
gcctactctgatgaatgtgatgcatgcggagctaagtttaatccgagtgaattaaaagat
ccacgcagtcagttaactgatgcaacaccagaattaaaagacaccgctcactggtggctg
aacatgtggaaagtcgctgatccgttaaaggcttggattgataccaaacaaaaagcttgg
cgcacaggtgttgttcaagaagtgacaaatacggttttaatcggctgtcgttttgaaaat
acgcacgaaccaaaatacaaagaaattaaagacactttaccaaaacacaaatctcgttac
gtgccgggtaaaaaagttgaatgtttatttgataacaaggctgatcttgcaactgcgcaa
tcaactcttgaagcttctggaattccatcaacgatcacagatcattggggccaccgccca
attacgcgtgacgtatcaaacggaattcctgtaccaccagaattagattctgaaatgaaa
ggcaaaacactttacgtgtggcctgattccttgatcgcaccgattgtgttttcacaagtg
gccttaaaacaatctggtcgtgatcctgaatcatacaaagatttctggtgtgatcctgaa
gccactgttgtgcagttcttaggacaagataacgttttcttttatgtgatcatgcaaggc
tctatgtggttaggccaacaaggcaacacacaagtcgctcctgccaaaggtgatttacaa
atgaccgagatcttaagcgtatttcacttaatggtgaatggcgaaaagatgagtaaatca
actggcaatttctattctggcgatcaactgttagagatgggttattcatctgaacaagtt
cgatattacctagcgatgttatcattacctgtgaaagcttcgaattttgattttgctcac
tttgcagaacgtaataaatttttagcgggcccgttaaacgctgccttagaaaaaccagtt
tcagcctgtaatggcaaattcggcggagttgttcctgagggtaagcttatcggcaaagct
gaagctgaaacgatgaagcttgtgcaaatgtacttacgctcaatgcaaaaaggtgattat
tcgactttacttggccaaattgaaaactacgcgcgccaaattaattctttattcacacaa
tttaaaccgcacgatgatcgtggtgttgaagctgatcgtaaagatgctttgttcacatgt
ttttatgttttaaaaaatttaatgatcatgcttgcgccatttgcgcctgagacaatgaac
gaagttcgtaaaacattaaacttacctgagagtgtgatggtcgcttcagaacttggtact
ggtatagctgcaggtcacaagatcggtgagaagcgcacttactttccggcagtggctggt
gcggaaactgctgctgagtaa

DBGET integrated database retrieval system