KEGG   Bdellovibrio sp. qaytius: CIK05_09340Help
Entry
CIK05_09340       CDS       T05880                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bdq  Bdellovibrio sp. qaytius
Pathway
bdq00260  Glycine, serine and threonine metabolism
bdq01100  Metabolic pathways
bdq01110  Biosynthesis of secondary metabolites
bdq01120  Microbial metabolism in diverse environments
bdq01130  Biosynthesis of antibiotics
bdq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bdq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CIK05_09340
Enzymes [BR:bdq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     CIK05_09340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AZZ36987
UniProt: A0A3T0RS98
Position
1928156..1929166
Genome map
AA seq 336 aa AA seqDB search
MRGFGSDNHSGVHPEILQALSGANIDHAPSYGTDPLTEKCQEMFKTFFGKTCEAYFVFNG
TASNVLSLKAMMKSHESCLVSDISHMNLDECGAPEFFAGKLIPVKSVEGKLTLPELEKHL
IRLGDQHYTQPRVVSLTQPTEVGTLYSLEEIKTISTWAKKHNLLVHMDGARFTNAVYKLN
CSMQAMTTDLGIDVLSFGGTKNGLMFGEAVVILNPALGKDFKYIRKQAAQLPSKTRFIAA
QFLAFFSNELYLKIAKHSCDMAQYFFETLSGKLKINYPVQSNALFAVIPQPLVKKLKQKY
FFYVWNETIFECRLMTSWDTQKSDIEGFCQALDEIL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcgtggatttggtagcgacaatcactccggcgttcaccctgaaattcttcaagcctta
agcggagcaaatattgatcatgctcccagttacggcactgacccgttaacagaaaaatgc
caagagatgtttaaaacttttttcggcaaaacatgtgaagcctattttgtttttaacggc
acagcctcaaatgttttatcattaaaagccatgatgaaaagtcatgagtcatgtttagtg
tctgacattagtcatatgaatctagatgaatgtggcgcccctgaatttttcgccggaaaa
cttattccggtgaaatctgttgagggaaaactcacactccctgaactagaaaaacatttg
attcgtttaggcgatcaacactacacccaacctcgtgtcgtaagtcttactcagcctact
gaagttggtactttatattcactagaagaaattaaaactatttcaacatgggctaaaaaa
cataatcttttagttcatatggatggcgcacggtttacgaatgcggtttataaattaaat
tgcagcatgcaagctatgaccactgatttaggcattgatgtgctttcttttggcggcaca
aaaaatggtttaatgtttggcgaagctgttgtgattttaaatccggctttaggtaaagat
tttaaatatattcgcaaacaagcggcgcaattgccttcaaaaactaggtttatcgcagca
cagttcttggcgttttttagcaatgaactttatttaaaaatagcgaaacattcttgtgat
atggctcagtattttttcgaaaccttatctggaaaacttaaaattaattatccggtgcaa
agcaatgcgctgtttgcagttattccgcagccactagttaaaaaactaaaacaaaaatat
tttttctatgtttggaatgagacaatatttgagtgccgtttgatgaccagttgggacact
caaaaatcagacatcgaaggcttttgccaagccctcgacgaaattctttaa

DBGET integrated database retrieval system