KEGG   Bdellovibrio sp. qaytius: CIK05_12330Help
Entry
CIK05_12330       CDS       T05880                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
bdq  Bdellovibrio sp. qaytius
Pathway
bdq03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bdq00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CIK05_12330
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bdq03011]
    CIK05_12330
Ribosome [BR:bdq03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CIK05_12330
  Bacteria
    CIK05_12330
  Archaea
    CIK05_12330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF4615
Motif
Other DBs
NCBI-ProteinID: AZZ37548
UniProt: A0A3T0RTQ0
Position
complement(2545401..2545733)
Genome map
AA seq 110 aa AA seqDB search
MEAKASLKYARVGAQKARLVADTVRGKSVDEALKILTVMNKKTAGLIKKLIESAVANADY
KKTMAVDKLIVKKLTVDGGPVLKRFRPRAQGRAFGVRKKLSHIDVVLGEK
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaagctaaagcatctttaaaatatgcaagagttggagctcaaaaggctcgcttggtt
gctgacaccgttcgcggtaagtcagttgacgaagctcttaaaattttgactgttatgaac
aaaaaaactgctggattaattaagaaattaatcgaatcagcagtggcgaatgcggattac
aaaaaaactatggctgtggacaagttaatcgttaaaaaattaactgtagacggtggtccg
gttttaaaacgtttccgcccaagagcgcaaggtcgtgcttttggagttcgtaaaaaatta
agtcacattgacgtagtattgggagagaaatag

DBGET integrated database retrieval system