KEGG   Betaproteobacteria bacterium UKL13-2: AEM42_09640Help
Entry
AEM42_09640       CDS       T04342                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
beb  Betaproteobacteria bacterium UKL13-2
Pathway
beb00071  Fatty acid degradation
beb00072  Synthesis and degradation of ketone bodies
beb00280  Valine, leucine and isoleucine degradation
beb00310  Lysine degradation
beb00362  Benzoate degradation
beb00380  Tryptophan metabolism
beb00620  Pyruvate metabolism
beb00630  Glyoxylate and dicarboxylate metabolism
beb00640  Propanoate metabolism
beb00650  Butanoate metabolism
beb00900  Terpenoid backbone biosynthesis
beb01100  Metabolic pathways
beb01110  Biosynthesis of secondary metabolites
beb01120  Microbial metabolism in diverse environments
beb01130  Biosynthesis of antibiotics
beb01200  Carbon metabolism
beb01212  Fatty acid metabolism
beb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:beb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AEM42_09640
   00630 Glyoxylate and dicarboxylate metabolism
    AEM42_09640
   00640 Propanoate metabolism
    AEM42_09640
   00650 Butanoate metabolism
    AEM42_09640
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AEM42_09640
   00072 Synthesis and degradation of ketone bodies
    AEM42_09640
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AEM42_09640
   00310 Lysine degradation
    AEM42_09640
   00380 Tryptophan metabolism
    AEM42_09640
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AEM42_09640
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AEM42_09640
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AEM42_09640
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:beb04147]
    AEM42_09640
Enzymes [BR:beb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AEM42_09640
Exosome [BR:beb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AEM42_09640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AMS32572
UniProt: A0A142LK26
Position
complement(2162735..2163913)
Genome map
AA seq 392 aa AA seqDB search
MSDSVVIVAAKRTPIGSMNGQLVGLTSPQLMSTAIKAAVAASGVKAEDITEAIIGCVLPA
ALGQAPARQAVLGADLLKSTACTTVNKVCGSGMKTTMMGYDAIMAGSASTVLVGGMESMS
NAPHMLPKARQGYRYGHFKALDHMAFDGLENAYDGKSMGIFADATAAKYGFTRQDQDAFA
AESVKRAQGAVASGAFTDEIAGVTVTVKGADTVLATDEPPGLCKPEKIPSLKPAFNKDGT
VTAASSSSISDGAAALILMKESDAIAKGIKPIARIVGHAQNAHEPEWFTTAPVGAIDKLH
KRLGWGPENVDLYEINEAFAVVAMAAMKDLNLPHTKVNVNGGACALGHPIGASGARLIVT
LLHALKARGGKRGIASLCIGGGEATAIAVEMF
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgtcagattccgttgtcatcgtcgccgcaaaacgtaccccgattggttccatgaacggc
caactggttggcctcacctcacctcaactcatgtccaccgcgattaaagcggcggttgcg
gcgtccggcgttaaagccgaagacattaccgaagcgatcatcggttgtgtgctgccggca
gccctcggccaagcgcccgcgcgtcaagcggtgctcggtgccgatttattgaaatctacc
gcctgcaccaccgtcaacaaggtgtgtggctccggcatgaagaccaccatgatgggttac
gacgcgatcatggcaggctcagcatcgaccgtattggttggtggtatggaaagcatgagc
aacgccccgcacatgctgccaaaggcacgtcaaggttatcgttacggccacttcaaggcg
ctcgatcacatggcctttgacggtttggagaacgcttacgacggcaaatcgatgggtatc
tttgccgatgcaactgccgccaagtacggcttcacgcgtcaagatcaggatgcgtttgcc
gccgagagtgtcaaacgcgcacaaggtgcggttgcctcgggtgcgttcacggatgaaatc
gccggtgtgaccgttacggtgaaaggtgccgataccgtgcttgcaaccgacgagccaccg
ggcctctgcaaaccggaaaaaattccgtcactcaagcccgccttcaacaaagatggcacc
gtcaccgccgcgtcctcctcctccatttcagatggcgcggcggcgctgattttgatgaaa
gaatccgacgcgatagccaagggtatcaagcccatcgcacgtatcgtcggccacgcacaa
aatgcgcatgaaccggagtggttcaccaccgcgccagttggggcgatcgataaacttcac
aagcgcttgggatggggcccggagaatgtcgatctttacgagatcaacgaagccttcgcg
gtggtggcgatggcggcgatgaaagatttgaacttgccgcacaccaaggttaatgtcaac
ggcggcgcgtgtgcgctcggccacccgatcggtgcatctggtgcacgcttgatcgtcacg
ctgttgcatgcgctgaaagcccgcggcggtaagcgcggtattgcatcactatgtatcggc
ggcggtgaagcgacggcgatcgcggttgaaatgttttag

DBGET integrated database retrieval system