KEGG   Betaproteobacteria bacterium GR16-43: BWI17_00400Help
Entry
BWI17_00400       CDS       T04726                                 

Definition
(GenBank) phosphopantothenate synthase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
beba  Betaproteobacteria bacterium GR16-43
Pathway
beba00770  Pantothenate and CoA biosynthesis
beba01100  Metabolic pathways
Module
beba_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:beba00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BWI17_00400
Enzymes [BR:beba01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     BWI17_00400
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     BWI17_00400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein
Motif
Other DBs
NCBI-ProteinID: APV48271
UniProt: A0A1P8FDV2
Position
77767..78990
Genome map
AA seq 407 aa AA seqDB search
MDKGLKILLGVTGGIAAYKAAELARLLIRNNVEVQVAMTDAGTKFVTPATFQALTGKPVV
TDAWDASFANNMAHIELSRGADAIVIAPATADFLAKLAQGHANDLLSTVCVARNCPLMVA
PAMNREMWDNPATQRNVATLRADGITVLGPAAGDQACGEVGMGRMMEPEDLVHDILAFFS
PKRLAGRKVLVTAGPTFEAIDTVRGITNLSSGKMGYAVAEAALAQGADVTLVSGPTAIAP
PARAHHVYVTSAAEMFNAVKAHVAGTDLFFSVAAVADYTPVEASNRKLKKSNTPLELHLK
PTEDILAYVAALPNAPFCVGFAAESENLAEYAQTKRAKKKIPMIVANLVQHAVGREENEV
TIYDDAGAHLLSRASKGQIAHRILAHALGLFEAKSPRATITPIKQAS
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggacaagggtttgaagatcctgctcggcgtgaccgggggcattgccgcctacaaggcg
gccgagctcgcgcgcctgctcatccggaataacgtcgaggtgcaggtcgcgatgaccgac
gccggaacgaaattcgtcacgcccgccacgttccaggcattgaccggcaagcccgtcgtc
accgacgcgtgggacgcgagcttcgcgaacaacatggcgcacatcgagctttcgcgcggc
gcggatgcgatcgtcatcgcgccggccacggccgacttcctcgcgaagctcgcgcagggc
catgcaaacgaccttctttccaccgtgtgcgtcgcgcgcaactgcccgctcatggtggcg
cccgcgatgaaccgcgagatgtgggacaaccccgccacgcaacgcaacgtggccacgctg
cgagccgatggcatcacggtgctggggcccgcagccggcgaccaggcgtgcggcgaagtc
ggcatgggccggatgatggagcccgaggatctcgtgcacgacatcctcgcgttcttctcg
cccaagcgcctcgcgggccgcaaggtgctcgtcaccgcgggcccgacgttcgaggccatc
gatacggtgcgcggcatcaccaacctctcctccgggaagatgggctatgccgtcgcggaa
gcggcactcgcccagggcgccgacgtgacgctggtctccggccccaccgcgatcgccccg
cccgcgcgcgcgcaccacgtctacgtgaccagcgccgccgagatgttcaatgccgtgaag
gcgcacgtggccggcaccgacctcttcttcagcgtcgcggccgtggcggactacacgccg
gtcgaggcgtcgaatcgcaagctcaagaaatcgaacacgccgctggagctgcacttgaag
cccacggaagacatcctggcctacgtcgcggcgctgcccaatgcgcccttctgcgtgggc
ttcgcggccgagagcgagaacctcgccgagtacgcgcagaccaagcgcgcgaagaagaag
atcccgatgatcgtcgcgaacctcgtgcagcacgccgtgggccgcgaagagaacgaggtc
accatctacgacgacgcgggcgcgcacctcctctcgcgcgcgtcgaaggggcagatcgcc
caccggatcctcgcgcacgccctcgggcttttcgaggcgaagtcgccgcgcgccaccatc
acccccatcaagcaggcctcctag

DBGET integrated database retrieval system