KEGG   Betaproteobacteria bacterium GR16-43: BWI17_17055Help
Entry
BWI17_17055       CDS       T04726                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
beba  Betaproteobacteria bacterium GR16-43
Pathway
beba00071  Fatty acid degradation
beba00072  Synthesis and degradation of ketone bodies
beba00280  Valine, leucine and isoleucine degradation
beba00310  Lysine degradation
beba00362  Benzoate degradation
beba00380  Tryptophan metabolism
beba00620  Pyruvate metabolism
beba00630  Glyoxylate and dicarboxylate metabolism
beba00640  Propanoate metabolism
beba00650  Butanoate metabolism
beba00900  Terpenoid backbone biosynthesis
beba01100  Metabolic pathways
beba01110  Biosynthesis of secondary metabolites
beba01120  Microbial metabolism in diverse environments
beba01130  Biosynthesis of antibiotics
beba01200  Carbon metabolism
beba01212  Fatty acid metabolism
beba02020  Two-component system
Brite
KEGG Orthology (KO) [BR:beba00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BWI17_17055
   00630 Glyoxylate and dicarboxylate metabolism
    BWI17_17055
   00640 Propanoate metabolism
    BWI17_17055
   00650 Butanoate metabolism
    BWI17_17055
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BWI17_17055
   00072 Synthesis and degradation of ketone bodies
    BWI17_17055
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BWI17_17055
   00310 Lysine degradation
    BWI17_17055
   00380 Tryptophan metabolism
    BWI17_17055
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BWI17_17055
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BWI17_17055
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BWI17_17055
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:beba04147]
    BWI17_17055
Enzymes [BR:beba01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BWI17_17055
Exosome [BR:beba04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BWI17_17055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: APV51237
UniProt: A0A1P8FMB2
Position
3621150..3622328
Genome map
AA seq 392 aa AA seqDB search
MAETIVIVAAKRTPIGSMQGKFNSVSASQLGAVAIRAAIEQAGVKPTEIDDVIFGCVLPA
GQGQAPARQAALGAGLDKSTPATTVNKMCGSGMKAAMMAADELSSGQATIVVAGGMESMT
NAPHLLPKARGGYRYGHQKVLDHMAFDGLENAYDGKPMGMFADATAAKYGFTREQMDAYS
KTSTERALAAVKSGAFKDEIAPVTVEGRKGNEVVSDDETPFSVNVDKIPTLRPAFNKDGT
VTAATSSSISDGAAALVMMTESEARKRGIKPLAKIISYASNAHEPEWFTTAPVGAIKKVL
DKAGWKAGDVDLFEVNEAFAVVTMAAMKDVGIPHEKVNVNGGAVALGHPIGATGARIITT
LIYALRKRGGKKGVAALCIGGGEATAIALEIL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaccatcgtcatcgtcgccgcaaaacgtacccccatcgggtccatgcagggc
aagttcaattccgtctcggcttcgcagctgggggcggtcgcgatcagggccgccatcgag
caggcgggcgtgaagcccaccgagatcgacgacgtgatcttcggctgcgtcctgcccgcg
ggccagggccaggcgcccgcgcggcaagccgcgctcggtgcgggcctcgacaagtccacg
cccgccacgaccgtgaacaagatgtgcggctcgggcatgaaggccgcgatgatggctgcc
gacgaactctcctcgggccaggcgacgatcgtcgttgcggggggcatggaatcgatgacc
aacgcgccccacctgctgccgaaggcgcgcggcggttaccgctacggccaccagaaggtg
ctggaccacatggctttcgacggcctcgagaacgcgtacgacggcaagcccatgggcatg
ttcgccgatgcgacggccgcgaagtacggcttcacgcgcgagcagatggacgcgtattcg
aagacttccaccgaacgcgcgctggccgccgtgaaatcgggtgcgttcaaggatgagatc
gccccggtcaccgtcgagggccgcaagggcaatgaagtcgtgtccgacgacgagacgccc
ttcagcgtgaacgtcgacaagatcccgacgctgcgccccgcgttcaacaaggacggcacg
gtgacggccgccacttcctcctcgatctccgacggcgccgcggcgctggtgatgatgacc
gagagcgaggccaggaagcgcggcatcaagccgctcgcgaagatcatctcgtacgcgtcg
aacgcccacgagcccgagtggttcaccacggcgcccgtcggtgcgatcaagaaagtgctc
gacaaggccggctggaaagcgggcgacgtcgacctcttcgaagtgaacgaagccttcgcc
gtcgtcacgatggcggcgatgaaggacgtcggaattccccacgagaaggtgaacgtgaac
ggcggtgcggtggccctgggccatcccatcggcgccaccggagcccggatcatcaccacg
ctcatttacgcactgaggaaacgcggcggaaagaaaggcgtcgcggcgctgtgcatcgga
ggcggagaagccaccgccattgccctggagatcctgtag

DBGET integrated database retrieval system