KEGG   Betaproteobacteria bacterium GR16-43: BWI17_19980Help
Entry
BWI17_19980       CDS       T04726                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
beba  Betaproteobacteria bacterium GR16-43
Pathway
beba00450  Selenocompound metabolism
beba00970  Aminoacyl-tRNA biosynthesis
beba01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:beba00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BWI17_19980
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BWI17_19980
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:beba01007]
    BWI17_19980
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:beba03016]
    BWI17_19980
Enzymes [BR:beba01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BWI17_19980
Amino acid related enzymes [BR:beba01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BWI17_19980
Transfer RNA biogenesis [BR:beba03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BWI17_19980
 Prokaryotic type
   Other AARSs
    BWI17_19980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f Ribosomal_60s
Motif
Other DBs
NCBI-ProteinID: APV51761
UniProt: A0A1P8FNU0
Position
4303146..4305329
Genome map
AA seq 727 aa AA seqDB search
MIALSPNASSMPRKLFVTTALPYANGPLHIGHFMEYVQADIWVRYQRLQGHKVNFVCADD
AHGAPIMLRAEAEGIPPEELIARVAEGHKRDLARFGISFDHFHTTHSDENRELSRSIFLD
LKKAGFIDTKTIEQFFDPVKGMFLPDRYIKGECPKCGTQDQNGDSCENCGAVYAPTDLKN
PYSVLTGAKPVLKKSEHFFFKLSDPRCVEFLRGWTQDGKLQPEVSNKVLEWLDGGLNDWD
ITRDAPYFGFEIPGAKGKYFYVWLDAPIGYLASLKSFLEKKGQDFDKYLADPKLEQIHFI
GKDIIYFHTLFWPAVLQFAGRKIPDRVYVHGFLQLSGEKMSKSRGVTVSPQRYIDLGLNP
EWVRYYLAAKLNDRVEDLDFNPEDFLARVNSDLVGKYVNIASRASGFISKRFGGKLSEEP
LSAGRELKHKMRGAVAPPAADDDQAPQILFEVRSFADAIAADYESREFGKALRQVMFLAD
RVNQYVDEQKPWEIAKEAGQDAALQWFCTLYLELFRILTIYLKPVLPKVAEEVEAFLGAA
KPYAWEDVSTPLKAGHVVQPYRHLVSRIDPKQIDQLLEPPEAKPEAGKPAAAAAAVASDA
PEFKLEPVEPPKPPVILPVGETISIDDFSRIDLRIARIVDAELIADADKLLKLTLDIGLE
QRTVFAGIRSAYTPKELVGRLTVMVANLAPRKMRFGESQGMVLAAGDGGSIYLLAPDSGA
APGMRIK
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcgctgtccccgaacgcttcctcaatgccccgcaagctcttcgtcaccacagca
ctcccctacgcgaacggcccgctccatatcggccacttcatggagtatgtgcaggccgac
atctgggttcgctaccagcggctgcagggacacaaggtgaatttcgtctgcgccgatgac
gcccacggcgcgcccatcatgctgcgcgccgaggccgagggcatcccgcccgaggagctg
atcgcccgcgtcgccgagggccacaagcgcgacctggcgcggttcggcatcagcttcgac
cacttccacacgacgcactcggacgagaaccgggagctgtcgcggtcgatcttcctcgac
ctgaagaaggccggcttcatcgacacgaagacgatcgagcagttcttcgacccggtgaag
ggcatgttccttccggaccgctacatcaagggcgagtgccccaagtgcggaacccaggac
cagaacggggattcctgcgagaactgcggcgcggtctacgcgcccaccgacctgaagaac
ccctactccgtgctgaccggcgccaagccggtgctgaagaagtccgagcatttcttcttc
aagctctcggacccgcgttgcgtcgagttcctgcgcggctggacccaggacggcaagctc
cagcccgaggtctcgaacaaggtgctcgagtggctggacggcggcctgaacgactgggac
atcacccgcgacgcgccgtacttcggtttcgagatccccggggccaagggcaagtatttc
tacgtctggctggacgccccgatcggctacctcgcctcgctgaagagcttcctcgagaag
aaggggcaggacttcgacaagtacctggccgacccgaagctggagcagatccacttcatc
gggaaggacatcatctacttccacacgctcttctggcccgccgtgctgcagttcgcgggg
cgcaagatcccggaccgcgtctacgtccacggtttcctgcagctctcgggcgagaagatg
tcgaagtcgcggggcgtgacggtgagcccgcagcgctacatcgacctgggcttgaacccc
gagtgggtgcgctactacctcgccgccaagctgaacgaccgcgtggaggacctggacttc
aaccccgaggacttcctcgcgcgggtgaactccgacctcgtgggcaagtacgtgaacatc
gcgagccgcgcctccgggttcatctccaagcgcttcggcggcaagctttccgaggagccg
ttgtcggccggccgcgagctgaagcacaagatgcgcggcgccgtggcgccccccgcggcc
gacgacgaccaggcgccgcagatcctcttcgaggtccgcagcttcgccgatgccatcgcc
gccgactacgagtcgcgcgagttcggcaaggcgctgcgccaggtgatgttcctcgccgac
cgcgtgaaccagtacgtcgacgagcagaagccctgggagatcgccaaggaagccggacag
gacgcggcgctccagtggttctgcacgctctacctcgagctcttccgcatcctcacgatc
tacctgaagccggtgctgccgaaagtggccgaggaggtcgaggccttcctgggcgcggcc
aagccctatgcctgggaagacgtctccacccccctcaaggccggccacgtcgtgcagccg
tatcgccacctcgtctcgcggatcgacccgaagcagatcgaccagctgctggagcccccg
gaggccaagccggaagcgggcaagccggccgccgccgccgcggccgtcgcgagcgacgcc
ccggagttcaagctcgagcccgtggagccgccgaagccgcccgtgatcctcccggtgggc
gagacgatctccatcgacgacttcagccgcatcgacctgcgcatcgcccgcatcgtggac
gcggagctgatcgcggatgcggacaagctcctcaagctcacgctcgacatcggcctcgag
cagcgcaccgtcttcgcgggcattcgctcggcctacacgcccaaggaactggtcggccgc
ctcaccgtgatggtggccaacctcgccccgcgcaagatgcgcttcggcgaatcgcagggg
atggtcctggcggccggagacggcggctcgatctacctgctcgcccccgattccggcgcc
gcgccgggcatgcgcatcaaatga

DBGET integrated database retrieval system