KEGG   Blochmannia endosymbiont of Polyrhachis (Hedomyrma) turneri 675: BTURN675_191Help
Entry
BTURN675_191      CDS       T03907                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
bed  Blochmannia endosymbiont of Polyrhachis (Hedomyrma) turneri 675
Pathway
bed03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bed00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BTURN675_191 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bed03011]
    BTURN675_191 (rplV)
Ribosome [BR:bed03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BTURN675_191 (rplV)
  Bacteria
    BTURN675_191 (rplV)
  Archaea
    BTURN675_191 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AKC59774
UniProt: A0A0E3Y6A5
Position
238258..238605
Genome map
AA seq 115 aa AA seqDB search
MQSKKCLVSVARCRYIRISAQKIRLVVNEIRGKAVLQAINILSFTNKKASRIVKKVLLSA
VANARHNYALDVESLKITKIFVDVGPSLKRIMPRAKGRADHILKRTSHVTVVVSN
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagtaaaaaatgtttagtcagtgtagctaggtgtcgttatattcgaatttccgct
caaaaaatacgtttagtagtaaacgaaattcggggtaaagctgttttacaagcaattaat
attttaagttttactaataaaaaagcttctaggatagtaaaaaaagtattattatcagct
gttgcaaatgcgagacataattatgctttagacgttgaaagtttaaaaattacaaaaatt
tttgttgatgttggtcctagtttaaaacgtataatgcctagagctaaggggcgtgctgat
catattttgaagcgtactagtcatgttactgtagttgtttctaactag

DBGET integrated database retrieval system