KEGG   Blochmannia endosymbiont of Camponotus (Colobopsis) obliquus 757: BOBLI757_021Help
Entry
BOBLI757_021      CDS       T03906                                 

Gene name
glyS
Definition
(GenBank) Glycine--tRNA ligase beta subunit
  KO
K01879  glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
ben  Blochmannia endosymbiont of Camponotus (Colobopsis) obliquus 757
Pathway
ben00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ben00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BOBLI757_021 (glyS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ben01007]
    BOBLI757_021 (glyS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ben03016]
    BOBLI757_021 (glyS)
Enzymes [BR:ben01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     BOBLI757_021 (glyS)
Amino acid related enzymes [BR:ben01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   BOBLI757_021 (glyS)
Transfer RNA biogenesis [BR:ben03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BOBLI757_021 (glyS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_synt_2f DALR_1 PHAT
Motif
Other DBs
NCBI-ProteinID: AKC60205
UniProt: A0A0E3Y8N5
Position
23824..25896
Genome map
AA seq 690 aa AA seqDB search
MKHTFFVEIGTEELPSRRLQELAKFFANNIHIELNHANIVHQEIKWFATSRRLAVKVVML
IDIHIYGFFENISSGIMQVFVDNGSPWSVIINNWAVTYNVKVKCSKYIVYSKNKWFMYRE
LMQDDTVHHLLCKVINNALKKTSNRIFMRWGKGDFKFIRPIHTVTVLLNDHVVSGNIFGI
NINRIICSHRFMGKSDIILSHADDYPSILMQQGFVISNYNQRKKIIQTGIKEVVKKIGGV
VKIEDSFLVEELTSLVEWPIVLVGSFKPKFLKLPKEVLIDVIEYNQKHFVVTNENKELLP
YFIFVINVKSTNREAIINGHETVIYSKLTDASYFFNIDSIVRLESYLPHLNNILFHRKIG
TLLDKTKRIEKLSAWIAIQLNADVSQAVRAAKLAKCDLLSNMVIEFPRTQGAIGMHYARR
DGESEVVSLAQKEYYYPRFSGDILPNTQISCILAIADRIDTISGIFSIKEYPKGNGDPFA
LRRAAIGILRIIIEKRIFLNLSFLVKQSVDLYNNNLSNKYLVDKIIDFLQGRLCIYYQNR
GYRNDVIRVILKNSLVNLIDFEKRLNVLHNFCRTEGFFLLKVLTKRVFNIIIKDDMISND
RPQVFLLRNIEEFNLFVKLFELDILLSDMLKKHCYLEILIELLKLSKLINVFFDHVMIMV
QNDELRINRLSLLSKAYRLLTILIDFSLLK
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatactttttttgtagaaattggtacggaagaattaccttcaaggagattacaa
gaattagcaaaatttttcgctaataatattcatattgaacttaatcatgcgaatattgta
caccaagaaataaagtggtttgctacatcacgtcgtttagcagtaaaagttgttatgttg
atagatatacatatttacggattttttgaaaatattagttcaggcattatgcaggtattt
gttgataatggctctccttggtcagtaattattaataattgggctgttacttataatgta
aaagttaagtgtagtaaatatatagtttattctaaaaataaatggtttatgtatagagaa
cttatgcaagatgacactgttcatcatttattatgtaaagtaattaataatgcattgaaa
aaaacatctaatcgtatatttatgagatggggaaaaggtgattttaaatttattcgtcct
atacatactgtaactgttttattaaatgatcacgttgtttcaggtaatatttttggtatc
aatattaatcgtattatatgtagtcatcgttttatggggaaatcagatataattttatct
catgctgatgattatcctagtattttaatgcaacagggttttgtgatatcgaattataat
caacgtaaaaaaattatacagacaggtattaaagaagtagttaaaaaaattggtggtgtt
gttaaaatagaagatagttttttagtagaggaattaacttcattagttgaatggcctata
gtgcttgttggaagttttaaacctaagtttctaaagcttccaaaagaagtattgattgat
gttatagaatataatcaaaaacattttgtagttactaatgaaaataaagaattattacca
tattttatatttgttataaatgtaaagtcaaccaatagggaagcaattataaatggacat
gaaacagtcatctattctaaattaacggatgctagttatttttttaatattgacagtatt
gtacgattagaaagttatttaccgcatttaaataatatcctatttcataggaagattggc
actttgttagataaaacaaaaagaatagaaaaactatctgcttggatagctattcaactt
aatgcagatgtaagtcaagcagtaagagcggctaagttagcaaagtgtgatttattaagc
aatatggtaattgagtttcctagaactcaaggtgctattggtatgcattatgcgcgtaga
gatggtgaatcggaagtggtttcattagctcaaaaagaatattattatccgcgattttct
ggagatattttgcctaatacacaaatttcttgtattttagctatcgctgataggattgat
actatatcaggtatttttagtattaaagaatatcctaaaggtaatggagatccctttgcg
ctacgtagagctgctattggtatattacgtatcattatagagaaaagaatatttttaaat
ttatcttttttagttaaacaatcagtagatctttataataataatttatccaataaatat
ttggttgataagataattgattttttacaaggacgtttatgtatttattatcaaaatagg
ggatataggaatgatgttattagagttattttaaaaaatagtttagttaatttaatagat
tttgaaaaaagattaaatgtattacataatttttgtcgaacagaaggtttttttttatta
aaagttcttactaaaagagtatttaatattattataaaagatgatatgatatctaatgat
aggcctcaagtttttcttttaagaaatattgaagaatttaatttgtttgttaagttattt
gaattagatattttattaagtgatatgcttaaaaagcattgttatttggaaattttaata
gaattattaaaattaagtaagttaattaatgttttttttgaccatgtgatgattatggta
caaaatgatgaattacgaattaatagattatctttattaagcaaagcatatagattgtta
acgatattaattgatttttcattattaaaatga

DBGET integrated database retrieval system