KEGG   Blochmannia endosymbiont of Camponotus (Colobopsis) obliquus 757: BOBLI757_075Help
Entry
BOBLI757_075      CDS       T03906                                 

Gene name
psd
Definition
(GenBank) Phosphatidylserine decarboxylase proenzyme
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
ben  Blochmannia endosymbiont of Camponotus (Colobopsis) obliquus 757
Pathway
ben00564  Glycerophospholipid metabolism
ben01100  Metabolic pathways
ben01110  Biosynthesis of secondary metabolites
Module
ben_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:ben00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BOBLI757_075 (psd)
Enzymes [BR:ben01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     BOBLI757_075 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: AKC60254
UniProt: A0A0E3Y7T1
Position
complement(90294..91175)
Genome map
AA seq 293 aa AA seqDB search
MLNKIQIVLQYILPKRWLTEVIGLIAQWRGGLITQWMIKLFIYIYRINMNEVQQTNITKY
PTFNTFFTRKLRSNARPINNNPSILVMPADGIISQIGQINKKYILQAKGHYYSLESLLAG
NNDMINYFENGNFSTIYLSPSNYHRVHMPCDGILRETLYIPGDLFSVNPLITKNIANLFA
RNERLICLFETNFGLIAQILIGAIIMGSIETVWLGTITPPRKGVIKHWHHAQSNKINKIV
LSKGQEMGLFKLGSTVINLFPKNKITFDHQLHSNHISKIGLPLAKINNIKIEQ
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgttaaataaaatacaaatagtactacaatacatattacccaaacgctggcttactgaa
gtaataggattaatagctcaatggagaggaggattaattactcaatggatgattaaatta
tttatttatatttaccgaattaatatgaatgaagtacaacaaacaaacataacaaaatat
cctacttttaacaccttttttactcgtaaactacgaagtaatgctagacctatcaacaac
aatccctcaatattagtaatgcctgcagacgggataatttctcaaataggacaaataaat
aaaaaatatatacttcaagctaaaggtcattattacagcttagaatccttactagcagga
aataacgatatgattaattattttgaaaatggtaatttctctaccatttatttatcccca
agtaattatcatagagtacatatgccatgtgatggaatattacgtgaaacattatacata
cctggagatttattttctgtaaatcctttaataacaaaaaacattgcaaatttatttgct
cgtaatgaacgacttatttgtttgttcgaaaccaacttcggactcatagcacaaatttta
ataggtgctattattatgggaagtattgaaactgtttggttaggaacaattactccacca
cgtaaaggagtaattaaacattggcatcatgcacaatcaaataaaataaataaaatagtt
ttatcaaaaggacaagaaatgggattgtttaaattaggatctactgtaattaacttattt
cctaaaaacaaaataacatttgatcaccaattacactcaaatcatattagcaaaataggt
ttacctttagctaaaataaataatataaaaatagaacaataa

DBGET integrated database retrieval system