KEGG   Blochmannia endosymbiont of Camponotus (Colobopsis) obliquus 757: BOBLI757_606Help
Entry
BOBLI757_606      CDS       T03906                                 

Gene name
metF
Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
ben  Blochmannia endosymbiont of Camponotus (Colobopsis) obliquus 757
Pathway
ben00670  One carbon pool by folate
ben01100  Metabolic pathways
ben01120  Microbial metabolism in diverse environments
ben01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ben00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BOBLI757_606 (metF)
Enzymes [BR:ben01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     BOBLI757_606 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: AKC60735
UniProt: A0A0E3Y9W7
Position
complement(724467..725366)
Genome map
AA seq 299 aa AA seqDB search
MVFYAIQWEKLNRYLVELYGNINVSFEFFPPYNYEMETFFWKAINSLGKLNPVFVSVTYG
ANTGTRDRTYNIIQDIKHRTGLIAAPHLTCIDATQQQLKNIAQKYWNSGIRHIIALRGDR
DRSVNYKHSTMMHAVDLVTLLKKIGDFDISVAAYPEVHPEAKNARDDLINLKRKIDAGAS
RAITQFFFDIENYLRFRDLCVSIGINVKIIPGILPIFNFQQLRRFSNMTQVKIPNWIVSM
FEGLSNSDIDTCKMIGVAIAIDMVKVLFKEGVRDFHFYTLNRSDLTYTICHVLGIRPKL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggtgttttatgctatacaatgggagaaattaaatcggtatttggttgaattgtacggt
aatattaatgtctcttttgaattttttcccccttataattatgaaatggaaacatttttt
tggaaggcaattaatagtttgggtaaattaaatcctgtatttgtttctgttacatatgga
gctaatacgggaacacgtgatcgcacttataatattatacaagatataaaacatcgtaca
gggctaattgctgcaccacatttaacttgtatcgatgcaactcaacaacagttaaaaaat
attgctcaaaaatattggaatagcgggattcgacatattatagcattgcggggagatcga
gatcgttcagttaattataaacattcaactatgatgcatgccgttgatttagtgacatta
cttaagaagataggtgattttgatatttcagtagctgcttatccagaagttcatcccgaa
gcaaagaatgcacgagatgatttaataaatttaaaaagaaaaattgatgctggtgcaagt
agagcgataactcagtttttttttgacatagaaaattatttaagatttcgtgatctttgc
gtttctatcggcattaatgttaaaattattcctggaattttacctatttttaattttcag
caattacgacgtttttctaatatgacacaagttaagattccaaattggattgtgtctatg
tttgagggattaagtaatagtgatatagatacatgtaaaatgattggggtggctattgct
attgatatggtcaaagtgttatttaaggagggtgtaagggattttcatttttatactctt
aatagatcggatcttacatatactatatgccatgtattagggattagacctaaattataa

DBGET integrated database retrieval system