KEGG   Blochmannia endosymbiont of Camponotus (Colobopsis) obliquus 757: BOBLI757_641Help
Entry
BOBLI757_641      CDS       T03906                                 

Gene name
metA
Definition
(GenBank) homoserine O-succinyltransferase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
ben  Blochmannia endosymbiont of Camponotus (Colobopsis) obliquus 757
Pathway
ben00270  Cysteine and methionine metabolism
ben00920  Sulfur metabolism
ben01100  Metabolic pathways
ben01110  Biosynthesis of secondary metabolites
ben01130  Biosynthesis of antibiotics
ben01230  Biosynthesis of amino acids
Module
ben_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:ben00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BOBLI757_641 (metA)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BOBLI757_641 (metA)
Enzymes [BR:ben01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     BOBLI757_641 (metA)
    2.3.1.46  homoserine O-succinyltransferase
     BOBLI757_641 (metA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTS
Motif
Other DBs
NCBI-ProteinID: AKC60769
UniProt: A0A0E3Y9Y7
Position
complement(771325..772218)
Genome map
AA seq 297 aa AA seqDB search
MPIRVLDKLPAVDFLRKENIFLMTTESSKNMTTVNSLKVLILNLMPKKIETENQLLRLLS
CSPLQIDVQLLRVDQHTPKNTPVGHLNNFYCNFIDIKNEKYDGLVITGAPLGLIKFCDVF
FWTKIKEIIQWAIQHVTSTLFICWAAQAALNILYDIPQMIRKNKLMGIYKHDTLDSFAFL
TRGFDDTFLAPHSRYTDFPTRIIRTNTDLEVLAASEEIGAYLFASYDKRIVCVTGHPEYD
SITLANEYFRDLRIGLNPVLPVNYFPQNNSNLIPTSTWRSHGCLLFTNWIHYYVNQV
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgccaattcgggtattagataaattacctgcagtagattttttacgtaaagaaaatatt
tttttaatgactactgaatcatctaaaaatatgacgacagtcaattcattaaaagtactt
attcttaaccttatgccaaaaaaaattgaaacagagaatcaattgttacgtttattatcc
tgttctcctttacagattgatgtacaattattacgtgtagatcaacatactcctaagaat
actcctgttggtcatttgaataatttctattgtaattttatagatattaagaacgaaaaa
tatgatggtttagttattactggagcaccattaggattaataaaattctgtgatgtgttt
ttttggacaaaaataaaagaaattatacaatgggctatacaacacgtaacttcaacttta
tttatttgttgggcagcgcaagctgcattaaatatattatatgatattccccagatgatt
cgtaaaaataaattgatgggtatttataaacatgatacattagattcgtttgcatttttg
acaagaggatttgatgatacatttttagcacctcattcacgttatactgattttcctaca
agaataatacgtactaatactgatttagaagttttagcagcatccgaagaaataggagct
tatttatttgctagttatgacaaacgaattgtttgcgttacaggacatccggaatatgac
agtataactttggctaatgaatattttcgagatcttcgtattggtttaaatccagtgtta
cccgtaaattattttccacaaaataattctaatttgatacctacatctacttggcgtagt
catgggtgtttattatttactaattggatccactattatgtcaatcaagtgtaa

DBGET integrated database retrieval system