KEGG   Bacillus filamentosus: BEH_00300Help
Entry
BEH_00300         CDS       T03983                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
beo  Bacillus filamentosus
Pathway
beo00450  Selenocompound metabolism
beo00970  Aminoacyl-tRNA biosynthesis
beo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:beo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BEH_00300
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BEH_00300
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:beo01007]
    BEH_00300
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:beo03016]
    BEH_00300
Enzymes [BR:beo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BEH_00300
Amino acid related enzymes [BR:beo01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BEH_00300
Transfer RNA biogenesis [BR:beo03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BEH_00300
 Prokaryotic type
   Other AARSs
    BEH_00300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f tRNA-synt_1c Zn-ribbon_8
Motif
Other DBs
NCBI-ProteinID: AKO90721
UniProt: A0A1X7GSM7
Position
50859..52823
Genome map
AA seq 654 aa AA seqDB search
MTEQKQSFYITTPIYYPSGNLHIGHAYTTVAGDAMARYKRLKGFDVYYLTGTDEHGQKIQ
RKAEEQGITPIEYVDNIVSGIKSLWSKLDISYNDFIRTTEERHKVVVEKIFDQLVKQGDI
YLDEYEGWYCTPCESFFTDRQLEDGKCPDCGRPVEKVREESYFFKMSKYADRLLQFYEEN
PTFIQPESRKNEMINNFIKPGLEDLAVSRTSFEWGIKVPNNPKHVVYVWIDALSNYITAL
GYGTEDDTKYQKYWPANVHLVGKEIVRFHTIYWPIMLMALDLPLPNKVFAHGWLLMKDGK
MSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERTNFDLANDLGNLV
NRTIAMINKYFDGEIPAYSGPVTEFDETLSAFQKQTVTKYEEAMEKMEFSVALTALWQFV
SRTNKYIDETQPWVLAKEEDKTNLASVMAHLAESIRHMAILLQPFLTQAPKGIFAQLGLE
DEKLQAWESLQQFGAIPAGVKVVKKGQPLFPRLDVEAEVAYIKEQMQGSAPAPKEEKKDT
KEEHQESSEITIDDFMKVDLRVAQVLKAEPVKKADKLLKIQLDLGYEQRQVVSGIAKFYT
PEELVGKKVICVTNLKPVKLRGELSQGMILAGEENGVLSLASVDQTLENGARVK
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgacagagcagaaacaaagtttttacattacaacccctatctattatccaagtggtaac
ctgcatattggacatgcttatacgacggtagctggggatgcaatggctcgctataaacgt
ttaaaggggtttgacgtatattatcttacaggaacagatgagcatggacaaaaaattcag
cgtaaagcagaagaacaagggattactcctattgaatatgtagataatattgtatctggt
attaaatctctttggagtaaattggatatttcatataatgactttatccgtacaacagaa
gaacgccataaagttgttgttgaaaagatttttgatcaacttgtaaaacaaggcgacatc
tatctagacgagtacgaaggatggtactgtactccttgtgaatcattctttacagatcgt
cagcttgaggatggaaaatgtccagattgtggccgtccagtagagaaggttcgagaagaa
tcttatttctttaaaatgagtaaatatgcagatcgtttactacaattttatgaagaaaat
ccaacgttcattcaaccagaatctcgtaaaaatgaaatgatcaataactttattaaacca
ggtcttgaagatttagcggtttctcgtacaagctttgagtggggaattaaagttccaaac
aatcctaagcatgttgtgtatgtatggattgatgctctatcaaactatattacagcactt
ggctatggtacagaggatgatacaaaataccaaaaatattggccggcaaacgttcacctt
gttggaaaagaaattgtacgtttccatactatttattggccaattatgttaatggcatta
gatttaccgttgccaaataaagtatttgcccatggttggttattaatgaaagatggaaaa
atgtcaaaatcaaaaggaaatgttgttgatcctgttactcttattgatcgctacggatta
gatgcattacgctattatctattacgtgaagttccatttggttctgatggagtctttaca
ccagagggatttgttgagcgtacaaactttgatttagcaaatgacttaggaaatcttgtg
aatcgtacaattgcaatgattaacaagtattttgatggtgaaatcccggcttacagtgga
cctgtaacagaatttgatgaaactctttctgcattccaaaaacaaacggttacaaagtat
gaagaagcaatggaaaaaatggagttctctgttgccctaacagctttatggcaatttgta
agccgtacaaataagtatattgatgaaacacagccatgggttcttgcaaaagaagaggat
aaaacgaatcttgcatctgttatggctcatttggcagaatctattcgtcatatggcgatt
cttttacaacctttcttaactcaagcaccgaaaggcatttttgctcaacttggacttgaa
gatgagaaacttcaagcatgggaaagccttcaacaatttggagcaatcccagcaggtgta
aaagtagtgaaaaaagggcagcctcttttcccacgtttagatgtggaagctgaggtagct
tatattaaagagcaaatgcagggcagcgctccagctccaaaggaagagaagaaagacacg
aaagaagaacatcaggaaagctcagaaatcacaattgatgattttatgaaagtggacctt
cgtgttgctcaagttctaaaagcagaacctgttaaaaaagcagacaagctactaaaaatt
caacttgatcttggttatgaacagcgtcaagttgtgtcaggtattgcaaagttctataca
cctgaagagttggtagggaaaaaagttatttgtgtaactaacttaaaacctgttaaactt
cgtggagaactttcacaaggtatgattttagcaggagaagaaaacggcgtattgtctcta
gcttctgttgatcaaactctagaaaatggtgcccgtgtgaagtaa

DBGET integrated database retrieval system