KEGG   Bacillus endophyticus: BEH_01945Help
Entry
BEH_01945         CDS       T03983                                 

Definition
(GenBank) asparaginyl/glutamyl-tRNA amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
beo  Bacillus endophyticus
Pathway
beo00970  Aminoacyl-tRNA biosynthesis
beo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:beo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BEH_01945
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:beo03029]
    BEH_01945
Enzymes [BR:beo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BEH_01945
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BEH_01945
Mitochondrial biogenesis [BR:beo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BEH_01945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: AKO90989
UniProt: A0A1X7FX99
Position
381819..382109
Genome map
AA seq 96 aa AA seqDB search
MSRISKEQVEHVAHLARLAITEEETEMFTKQLDAIITYAEQLNELDTTGVKPTTHVLEVK
NVMREDKPTKGLPREEVLKNAPDHQDGQVRVPSILE
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgaatttcaaaagaacaagtagagcacgttgcacatcttgcacgtttagcgatt
actgaagaagaaacagaaatgtttacaaagcaattggatgcaattattacatatgcagaa
cagttgaatgagttagatacaacaggtgttaaaccaacaacacacgttcttgaagtgaag
aatgtaatgcgtgaagataaaccaacaaaagggttaccacgtgaagaagtgttaaaaaat
gcaccggatcatcaagatggacaagttcgcgttccatcaattttagaatag

DBGET integrated database retrieval system