KEGG   Bacillus endophyticus: BEH_02020Help
Entry
BEH_02020         CDS       T03983                                 

Definition
(GenBank) sugar dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
beo  Bacillus endophyticus
Pathway
beo00030  Pentose phosphate pathway
beo01100  Metabolic pathways
beo01120  Microbial metabolism in diverse environments
beo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:beo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BEH_02020
Enzymes [BR:beo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     BEH_02020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Polysacc_synt_2 Epimerase THF_DHG_CYH_C
Motif
Other DBs
NCBI-ProteinID: AKO91004
UniProt: A0A0H4KFF0
Position
397742..398527
Genome map
AA seq 261 aa AA seqDB search
MYTDLKDKVVVITGGSTGLGRAMAVRFGEEEARVVINYWNNEEEALEAKKEVEEAGGKAI
IVQGDVTKEEDVINLVQTAVKEFGTLDVMINNAGVENPVPSHELTLDNWNKVIDTNLTGA
FLGSREALKYFVENDIKGNVINMSSVHEMIPWPLFVHYAASKGGMKLMTETLALEYAPKG
IRVNNIGPGAMNTPINAEKFADPEQRADVESMIPMGYIGDPKEVANVAAFLASSQASYVT
GITLFADGGMTKYPSFQAGRG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtatacagatttaaaagataaagttgtcgttattacaggtggatctactggtttagga
cgagcaatggctgttcgtttcggagaagaagaagctcgtgttgttatcaactattggaat
aatgaagaagaagcgttagaagcaaaaaaagaagttgaagaagcaggcggaaaagcaatc
attgttcaaggtgacgtaacaaaagaagaagacgttattaatcttgttcaaacagctgta
aaagaattcggtacacttgatgtaatgattaacaacgcgggtgttgaaaaccctgttcca
tctcatgagcttacattagataactggaataaagttattgatacaaacttaacaggagca
ttccttggtagccgtgaagctcttaaatactttgtagaaaacgatattaaaggaaatgta
atcaacatgtctagtgttcatgaaatgattccttggccactatttgttcattatgcagca
agtaaaggcgggatgaagctaatgactgaaaccctagcacttgaatatgctccaaaaggc
attcgtgttaacaacattggtccaggtgcaatgaacacaccaattaatgctgagaaattt
gcagatcctgagcagcgtgcagacgttgagagcatgattccaatgggatacattggagac
cctaaagaagtagcaaatgttgcagcattcttagcttcttctcaagcaagctatgtaaca
ggaattacgctatttgctgacggtggtatgacaaaatatccttctttccaagctggtaga
ggttaa

DBGET integrated database retrieval system