KEGG   Bacillus endophyticus: BEH_02255Help
Entry
BEH_02255         CDS       T03983                                 

Definition
(GenBank) phenolic acid decarboxylase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
beo  Bacillus endophyticus
Pathway
beo00130  Ubiquinone and other terpenoid-quinone biosynthesis
beo00627  Aminobenzoate degradation
beo01100  Metabolic pathways
beo01110  Biosynthesis of secondary metabolites
beo01120  Microbial metabolism in diverse environments
beo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:beo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    BEH_02255
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BEH_02255
Enzymes [BR:beo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     BEH_02255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein MgtE Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: AKO91044
UniProt: A0A1X7FXE0
Position
452253..452831
Genome map
AA seq 192 aa AA seqDB search
MKVIVGMSGATGAIFGIRLLEILKNTEIETHLVMSSWASATIRVETPYTAKEVEKLADYT
YSYKDLGAKISSGSFQVDGMIVAPCSMKTLASIRMGLADNLVTRAADVILKERKKLLLLT
RETPLNDIHLENMLALSRMGTMIFPPMPAFYNHPENIDDLINHIVYRALDQFGIHLSDAK
RWDGIQKVENKN
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaattgtagggatgtcaggagccaccggagctatttttggaattcgccttttg
gagattcttaaaaacacagagatagagactcatttagtcatgtcttcatgggcatccgca
actatccgagtggaaacgccttacacagcgaaggaagttgaaaaattggctgattatact
tattcttataaagatttaggagccaaaatttctagcgggtctttccaagtggatgggatg
attgttgctccctgtagtatgaaaacattagcctctattcggatggggttagcagataat
cttgtaacacgtgcagctgatgttatattaaaagaacggaaaaagctgttattattaaca
cgtgaaactccccttaatgatatccatcttgaaaacatgttggcgttatcacgtatggga
acaatgattttccctccaatgcctgctttttataatcatccggaaaatattgatgattta
attaatcatattgtatacagagcattagatcagtttggtattcatctatcagacgcaaaa
agatgggatggaatacaaaaagtagagaataaaaactag

DBGET integrated database retrieval system