KEGG   Bacillus filamentosus: BEH_04550Help
Entry
BEH_04550         CDS       T03983                                 

Definition
(GenBank) tryptophan 2,3-dioxygenase
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
beo  Bacillus filamentosus
Pathway
beo00380  Tryptophan metabolism
beo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:beo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    BEH_04550
Enzymes [BR:beo01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     BEH_04550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_dioxygenase
Motif
Other DBs
NCBI-ProteinID: AKO91432
UniProt: A0A0H4KBF6
Position
complement(917334..918182)
Genome map
AA seq 282 aa AA seqDB search
MKNMTSKNNSRPEQNIQTDFQKEMSYGDYLHLHKILDSQQRLSGHHDEMLFIIIHQTSEL
WMKLILHEVKAAISCIRNDNLEASFKMLSRVSRIQQQLIQSWNILSTLTPAEYMEFRDDL
GKSSGFQSYQNRLIEFSLGNKNAHTLAVYKHDKNLFNQMQQALHEPSIYDEAVKAMFRRG
LPINEQCLNRDYSEQYEPNESIELAWLEVYRNVNQYWDLYELAEKLVDIGSQQQLWRFNH
VTTVERIIGHKTGTGGSSGVTYLKRALDQHFFPELWSLRTKI
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatatgacgtcaaaaaacaattctcgcccagagcaaaatattcaaactgacttt
caaaaggaaatgtcttatggtgactatcttcatcttcataaaatcttagatagtcagcaa
agactttctggtcatcacgacgaaatgttatttattattattcatcagacaagtgaacta
tggatgaagcttattttgcacgaagtgaaggccgctattagctgcatacgcaatgataat
ttagaagcctctttcaaaatgctttctcgtgtttctcgtattcaacaacagctcattcaa
tcttggaacatcctctcgactttaacacctgctgaatatatggaatttagagacgatctt
ggaaagtcttctggatttcaatcataccaaaatcggcttattgaattttctttaggaaac
aaaaatgctcatactctagctgtctataaacatgataaaaaccttttcaatcaaatgcag
caagcacttcatgagccaagtatatatgatgaagcagtcaaagctatgtttaggcgtggc
ttaccaattaacgagcaatgtctgaacagagactattccgaacaatatgagccaaatgaa
agcatcgaattggcttggcttgaagtttatcgcaatgttaaccaatattgggatttatat
gagctagctgaaaagctagttgacattggaagccaacagcaattgtggcgcttcaatcat
gtgacaacagttgagagaattatcggtcataaaactggaacaggagggtcttctggggta
acgtacttaaaaagagcacttgatcagcatttcttccctgaactgtggagccttcgcaca
aaaatttag

DBGET integrated database retrieval system