KEGG   Bacillus filamentosus: BEH_09660Help
Entry
BEH_09660         CDS       T03983                                 

Definition
(GenBank) galactarate dehydratase
  KO
K01708  galactarate dehydratase [EC:4.2.1.42]
Organism
beo  Bacillus filamentosus
Pathway
beo00053  Ascorbate and aldarate metabolism
beo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:beo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    BEH_09660
Enzymes [BR:beo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.42  galactarate dehydratase
     BEH_09660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GD_AH_C SAF TMEM126
Motif
Other DBs
NCBI-ProteinID: AKO92337
UniProt: A0A1X7E2U6
Position
complement(1936735..1938270)
Genome map
AA seq 511 aa AA seqDB search
MSISKKQKSTPLYIKVHESDNVAIVVNEGGLSKDTMFPCGLKLIDDVPQGHKVSLTSLSI
GEPIIRYGEIIGYAREVLQKGSRIKESDVSLPVPPTLSELIQDSTKTEEMEPINGYTFLG
YENNDGSVGTKNILGITTSVQCVVGVLDYAVERVKKELLPHYPNVDDVVALNHNYGCGVA
IDADDAAIPIRTVQNLMKHPNFGGEVMVVGLGCEKLTTSQLLSSDDKRDVVLLQEEQGFH
GMLETIMKMAEEKLKRLNKRERTLCSLSNLVVGLQCGGSDAFSGVTANPAVGYAADLLVR
AGATVFFSEVTEVRDAVHLLTPRAANEDVQRKLVKEMEWYDRYLERGKADRSANPSPGNK
KGGLTNVVEKALGSIVKSGRSPIVDVLAPGEKATKKGLHYAATPASDFVCGTLQLASGMN
LHVFTTGRGTPYGLAMAPVIKVSTRNALKEQWHDLIDINAGEIATGNATIEDIGTELFHY
MIDVASGKKKTWADYWKLHNDLCLFNPAPLT
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgtcaataagtaaaaaacaaaaaagtacccctctttatattaaagtacatgaaagtgat
aacgtggccattgttgtaaatgaaggtggtctttcaaaagacacgatgtttccctgtggt
ttaaaactcatcgatgatgttccacaaggtcataaagtttcacttacttctttgtccatt
ggagaacccattatacgatatggagaaattattggatatgctcgtgaagtgttacaaaaa
ggaagccgtattaaagaaagtgatgtctcgctccctgttcctccaacattatcagaactt
attcaagacagcactaaaacagaagaaatggagcctataaacggatatacattccttggc
tatgaaaacaacgacggtagtgtgggaacaaaaaatatcctcggaattaccacaagtgtc
caatgtgttgtcggtgttctggattatgccgtagaacgtgtaaagaaagaacttctcccc
cattatccaaatgttgacgacgttgtagctttaaaccataactatggctgtggagttgct
attgatgcagatgatgctgccattcctattcgtactgtccaaaatttaatgaagcatcca
aactttgggggagaagtgatggttgttggacttggatgtgaaaagctaacaacaagtcag
cttttatcaagcgatgataaacgagacgttgttctcctgcaagaagagcaaggatttcac
ggtatgcttgaaacaattatgaaaatggctgaagaaaaattaaaacggttaaataaacga
gaacgcacattatgctctctatccaacctagttgttggcttacaatgtggaggaagtgat
gctttctctggagtaacggctaaccctgctgttggatatgcagcagatcttctcgtccgt
gctggggcaactgtcttcttttctgaagtaacagaagttcgtgatgctgttcatttgtta
acaccacgagcggcaaacgaagacgtacaaagaaagttagtaaaagaaatggaatggtac
gatcgctacttagagcgaggaaaagctgatagaagtgcaaacccttcaccaggcaataaa
aaaggggggttaacaaatgttgtggaaaaggcacttggttctatcgttaaatctggaaga
agtccaatcgtagatgtattagctcctggagaaaaggcgactaaaaaaggtcttcactat
gccgcaacacctgcaagtgattttgtttgtggaacgttgcaactggcctctgggatgaat
ttgcacgtttttacaacaggacgcggtactccttatggtttagcaatggctcctgttata
aaagtgtctacacgaaatgctttgaaagagcagtggcatgatttaattgatattaacgca
ggagaaattgcaaccggaaatgcgacaatcgaagatattggcacagagctttttcattat
atgattgatgttgcaagcggtaaaaagaaaacatgggcagactactggaagcttcataat
gacctttgcttattcaatcctgctcccctcacttaa

DBGET integrated database retrieval system