KEGG   Bacillus endophyticus: BEH_13105Help
Entry
BEH_13105         CDS       T03983                                 

Definition
(GenBank) fuculose phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
beo  Bacillus endophyticus
Pathway
beo00051  Fructose and mannose metabolism
beo01100  Metabolic pathways
beo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:beo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BEH_13105
Enzymes [BR:beo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BEH_13105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II DUF2073
Motif
Other DBs
NCBI-ProteinID: AKO92941
UniProt: A0A1X7EI19
Position
complement(2645317..2645985)
Genome map
AA seq 222 aa AA seqDB search
MNYKQQLMNTGKYLISNQLAWGTSGNISVRTDPDEMLITASGTYMANLSEDDFVKFNIST
GQNYSERKASKETPMHLGIYQKREDINAVLHSSPFYTTLFSCSNEAIISKLFVETMYYLE
DIAYVDYFHPGSQELAEAVTAQASNANIIIMKNHGVVVLDESLLEAQMRLQTLEMACHMI
LKAKESGIKLSLIPQKTVQSFLNESFYKPRKTVNHSIKPSNK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaattacaaacagcaattaatgaatacaggaaagtatcttatctcaaatcagctagca
tggggaacatcaggaaatataagcgttaggactgatcctgatgaaatgcttatcacggcc
tccggaacatatatggctaatctatcggaagatgattttgtaaagtttaatatttctaca
ggtcagaattacagtgagaggaaagcctccaaagaaacacccatgcatctcggaatttat
cagaagcgtgaagacataaacgcagtcttacattcatcgccattttatacgactttgttt
tcttgtagtaatgaagccattatttctaaattatttgtagaaacgatgtattatctagag
gatattgcttacgtagactattttcaccctggttcacaagaattagctgaggctgtaact
gctcaagcatccaacgccaatatcatcattatgaaaaatcatggggtagtagtattggat
gagtctttattagaagctcaaatgagactacaaactttagagatggcatgtcatatgatt
ttaaaagcaaaagaatcagggattaaacttagcttaattccacagaaaactgtacaaagt
tttttaaatgagtccttttataaaccaagaaagacagtgaatcattctattaagcctagt
aataaatga

DBGET integrated database retrieval system