KEGG   Bacillus endophyticus: BEH_16925Help
Entry
BEH_16925         CDS       T03983                                 

Definition
(GenBank) hypothetical protein
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
beo  Bacillus endophyticus
Pathway
beo00860  Porphyrin and chlorophyll metabolism
beo01100  Metabolic pathways
Module
beo_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:beo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BEH_16925
Enzymes [BR:beo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     BEH_16925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AKO93608
UniProt: A0A0H4KZ36
Position
complement(3461448..3462065)
Genome map
AA seq 205 aa AA seqDB search
MDHHVVISAVRHGITAYNKRKAYMGWSNPPLLEEALTKITPYEKEDVLVVGSDLKRCEET
AEALFPKAPYHSFKEWRELHFGEWEGKTYHELRDDVQYRKWVNQPFTREIPGGETYTDFK
ERINQALFYSLNGLKKSGKTKLVIVTHGGVIRSLHERFLKENNVFWNLNIGYTEAITWKM
TYERVRRDEACISYSEGLLTESVSG
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggatcatcatgtggttatttcagctgttcgtcatggcataacagcatataataaaagg
aaagcatatatgggatggagcaatccaccgcttttagaggaagcgttaacgaagattact
ccttatgaaaaagaggatgtacttgttgtagggagtgatttgaaacgttgtgaagaaaca
gcagaggctctctttccgaaagctccttatcattcttttaaagagtggcgtgagctacat
tttggagagtgggaaggaaaaacgtatcatgaactaagagatgatgtacagtaccgaaaa
tgggtgaatcagccctttacacgtgaaataccaggcggtgaaacgtatacagacttcaaa
gagcgcatcaatcaagctcttttttatagtttaaacgggttaaagaaaagtggaaaaaca
aagttagttattgtaacacatggaggagtgattcgctctttacatgagcgttttttaaag
gaaaacaatgtgttttggaacttgaatattggttatacagaagctatcacatggaagatg
acatatgaaagagtaaggagggatgaggcgtgcatttcgtattcggaggggcttttaacg
gaaagcgtcagtggatag

DBGET integrated database retrieval system