KEGG   Bacillus filamentosus: BEH_25990Help
Entry
BEH_25990         CDS       T03983                                 

Definition
(GenBank) noncanonical pyrimidine nucleotidase, YjjG family
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
beo  Bacillus filamentosus
Pathway
beo00361  Chlorocyclohexane and chlorobenzene degradation
beo00625  Chloroalkane and chloroalkene degradation
beo01100  Metabolic pathways
beo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:beo00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BEH_25990
   00361 Chlorocyclohexane and chlorobenzene degradation
    BEH_25990
Enzymes [BR:beo01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     BEH_25990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD
Motif
Other DBs
NCBI-ProteinID: AWG44812
UniProt: A0A2L1FFJ1
Position
pBEH5:complement(4459..5154)
Genome map
AA seq 231 aa AA seqDB search
MKYEIILFDIDDTLFDFSMSEREALHKTFVEFELPTGLAEYEANYKEISKGLWRDLEQGL
TTLSELGVERFRRLFLGHELEINADTFNSIYLEYLGKEIHLVKGAVELCDNLAGYRLAII
TNGFTDVQTSRIGSSPLCNTFEHIIISEEAGFQKPGKGIFDYAFSKLQITDKTKVLIVGD
SLTSDIQGGINYGIDTCWFNPHFKENNIGIKPTYEIRELTDLIQIIGKMDS
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacgaaatcatattgtttgatattgatgatacattatttgacttcagtatgtcg
gaaagggaagcactacataaaacttttgtagagtttgaattgcccacgggcttggcggaa
tatgaagccaactacaaagagattagcaagggattatggagagatctggaacaggggctt
actactttatcagaactgggagtagagagatttaggagattgttccttgggcatgagctt
gaaataaacgcagatacgttcaacagtatttatcttgaatatttgggcaaggaaatacat
cttgtaaagggagccgtagaattatgtgacaatcttgccggctatcggctggccattata
acaaacggatttacggatgtgcagacatcaagaatcgggagctcccctctctgtaatact
tttgagcatattattatttctgaagaggctggatttcagaagccaggaaagggtattttc
gattatgcgttttccaagctacagattacagataaaaccaaagtgttgattgtgggtgat
tctttgacctctgatattcaggggggaataaattacgggattgacacctgctggttcaat
ccgcattttaaggaaaacaatatagggattaagccaacgtatgaaatccgtgagttgacg
gatcttatacagattatagggaagatggatagttga

DBGET integrated database retrieval system