KEGG   Theileria equi: BEWA_002280Help
Entry
BEWA_002280       CDS       T02820                                 

Definition
(RefSeq) helicase associated domain HA2 containing protein
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
beq  Theileria equi
Pathway
beq03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:beq00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    BEWA_002280
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:beq03041]
    BEWA_002280
Enzymes [BR:beq01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     BEWA_002280
Spliceosome [BR:beq03041]
 Complex C
  Other components
   Step II factors
    BEWA_002280
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind S1 Helicase_C AAA_22 T2SSE DEAD AAA_16 AAA_29
Motif
Other DBs
NCBI-GeneID: 15805696
NCBI-ProteinID: XP_004830487
UniProt: L0B0N2
Position
3
AA seq 1171 aa AA seqDB search
MSLEELQALSAVAKVTEMLKNHLDLDHTELAEFIIHLAKKARDLDDFSRLLDENESDMSS
DFVAQLYRIIIALDPPNDHGSWDSIIRDEANDAINFPALALKNDQNREELKEVEKSDELS
EWAKELLEREKGHSKRTHENQYDRRKHIDHRDRRSRSQSYEASSRRREHRDYRNRRDDHR
DKSDYGDRDHDRKDIHSHRGNYRREYRRERSDSHSRDKRRHRRDYSSSSSRSVESRSHKD
KRYGDEYPNPESLEGSIFPGRVTNITDFGAFVSFKTPLGDREGLVHKSEISSTRRIIEVS
QVLKRGMNVYIKILKVIGEKFRLTMKDIDQTNGSEIKRVTETVHDDFYDNHKHSDYGTGE
QSITGISVDEYTQGIEGRRKRLISDVEKWEQQQLLNSGILSKEEKKNIYIENEPTEEEPE
IEISDACPTFLKGQTTRSGIMLSPIKIIANPEGSLARTITTSITLAKERKEMERENEDAV
APVNTSLRMHESLRNWRTPLAAKESTNQSIKDQRESLPVFQLRRDLLDKVREHHILIVIG
ETGSGKSTQIPQYLQEVGYSRVGMIGCTQPRRVAAKSVAARVAKEFGCNVGEEVGYCIRF
DDCTSPSTCIKYMTDGMLLREVLQDPILEKYSAIMLDEAHERTIATDVLFALLKDCASKR
PDFRLIVTSATLEAEKFSSYFFNCPIFTIPGRSFPVEILHVKEQEHDYLEASLQAVLHIH
LNEGPGDILLFLTGQEDIEAACKILQQRMARLEEVKPPPLIVLPVYAALPSEVQHAIFEA
APPGCRKCIVATNIAEASITIDGIFFVVDPGFAKVKHYNARAGMESLAIVPISRANAQQR
AGRAGRTGPGKCYRLYTEHAYHNEMISTPIPEIQRTNLSTVVLILKAMGINDFIHFDFMD
KPPIETLIDAMENLYHLGALDDDGLLTRLGRKMAEFPMDPNMAKMLLSSIDLLCSDEIIT
IIAMLSVQNIFYRPRDKQAQADQARSKFIQSEGDHVTYLQLYSAWQRNKFSDHWCKEHFV
QHGALRRAQDVRKQLISIMDRYRFKVVSAGKNFERISKAICSGFFHHSAKRDPQEGYRTV
VDQQQVYIHPSSALHLRNPEYVVYHELVMTTKEYMRDLTVVKGQWLLDVAPSMFKKSDGS
SIPKHKANFKIEPLHNKFQDKDAWRLSKRRG
NT seq 3516 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttggaggagctgcaggcgctcagcgctgtggccaaggtaaccgaaatgctcaag
aatcacctggacctcgaccatacggagcttgcggaattcataattcacctggcaaaaaag
gccagggatttggacgatttcagtaggttgttggacgagaatgagtctgacatgagctct
gactttgtggctcaattgtatcgcataattatcgctctagatcccccaaatgatcatggt
tcgtgggactctataatcagagatgaagcaaatgatgctataaattttccggcgctagcc
ctgaaaaatgaccaaaacagggaggaattgaaggaggtagaaaagagtgatgaattgtcc
gaatgggcaaaggaacttttagagagagaaaaggggcactccaaacgaacacacgaaaat
caatatgatcgccgtaaacatatagaccacagggacaggagatcccgatctcaaagctat
gaagcaagttcccgtagacgagaacatagggattacagaaatcgcagggatgatcacaga
gataagagcgactacggagatagggatcatgacagaaaagatatccatagtcacagaggc
aattaccgaagagaatatagacgagaacgctcagattcacattctagagataaacgtaga
cacagacgtgactactcatcttctagtagccgatctgtggagtctagaagtcataaggat
aaacgctacggcgatgaatatcccaatccagaatctctagaaggctcgatattccctgga
agagtcacaaatataaccgactttggagcattcgtctcatttaaaactccacttggagat
agagagggtctagttcacaagtctgagatttcaagtactagaagaattattgaagtttcc
caagttctcaaaagaggaatgaatgtgtatataaaaattttaaaggttatcggtgaaaag
ttccgacttacaatgaaggatattgatcaaaccaacggtagtgagattaaaagggtcact
gaaactgtacatgacgatttctatgacaatcataaacatagtgactatggtactggtgag
cagtcgatcacaggaataagtgtagacgaatacacacaaggtatagagggaagaagaaag
agactcataagtgatgttgagaagtgggaacagcaacaactattaaattccggaattttg
agcaaagaggaaaagaagaatatatatattgaaaatgaaccaactgaggaggaacctgaa
attgagattagtgacgcgtgtccaacatttttaaagggacaaaccaccagatcaggaatt
atgttatctcctataaaaataatcgcaaacccggaaggttctcttgcacgtacaataacc
acgagtataactcttgccaaagagaggaaagaaatggagagagaaaatgaggatgcagta
gcacctgtaaacaccagtctgcgcatgcacgagtccctgaggaattggcgtaccccctta
gctgctaaagaatctacaaatcaaagtatcaaggatcaaagggaatctctaccggtgttc
caactaagaagggatcttttagacaaggttcgtgagcatcacattttgattgtaatcggt
gaaactggaagcggtaaaagtacacagatcccgcaatacctacaggaagttggctactcc
agagtaggaatgattggatgtactcagcctagaagggttgcagcgaaatctgtagcggca
agagtagcaaaggaatttggatgtaatgtaggtgaagaagttggatattgcataagattt
gacgactgtacatcaccaagtacttgtataaagtacatgaccgatggtatgctcctaaga
gaagtcctacaagatcccatactggagaaatattcggcaattatgcttgatgaagctcat
gagcgcacaatcgcaaccgatgttctattcgctttgctaaaggactgtgcatcaaaaaga
ccggattttcgattgattgttacgtctgcgactttggaggctgaaaagttctcatcctac
tttttcaactgtcctatatttaccattcctggaaggtcatttccggtggaaattttgcat
gtgaaagagcaagagcacgactatcttgaagcatccttacaagcagttttacacattcat
ctcaacgaaggtcctggggatatcctgctgtttctaaccggtcaagaagatattgaagct
gcatgcaaaattctccagcaaagaatggccagactggaagaggttaaaccaccccctctt
attgtacttccagtctatgctgccctcccaagtgaggtacagcatgctatctttgaggct
gcgccgcctggatgtagaaaatgtatcgtggctactaacattgcagaagcttccattaca
atcgatgggatatttttcgtggtagatcctggtttcgccaaggtaaaacattacaatgct
cgtgccggaatggaatcacttgccattgttccaatctccagggccaatgcgcagcaaagg
gccggaagagcgggaagaaccggacctggaaaatgctaccgtctatacactgagcatgca
tatcataatgaaatgattagtacaccaattcctgaaattcagagaaccaacttgtctaca
gttgtacttatcctcaaagctatgggcattaacgatttcatacattttgactttatggat
aaacctccgatagagacccttatagatgctatggagaacttgtatcacttgggggctcta
gatgatgatggattactcacaaggttaggaaggaaaatggctgaattcccaatggaccca
aatatggcaaagatgctcctatcgtctatcgacctcctctgttccgatgaaattataaca
atcatcgccatgttgagtgtacagaatatcttttatagacctagggataaacaagcacaa
gccgatcaggccaggtcaaagttcattcagtctgagggagatcatgttacatatctacaa
ttatactctgcgtggcaaaggaacaagttctctgatcactggtgtaaagaacattttgta
caacacggagcgttgagaagggctcaagatgtaaggaaacaactaatttccataatggat
agataccgctttaaagttgtctctgcaggaaaaaattttgaaaggatatccaaggcgata
tgctctggattcttccatcactctgcaaaacgagatccacaggaaggatacagaactgtc
gtcgatcaacagcaggtctacatacatccgtcttcggcgctccatctgagaaatcccgag
tatgtcgtataccatgagctagtaatgactacaaaagagtacatgcgtgatttgacggtt
gtaaagggacagtggctgctcgatgtagctccatcaatgttcaaaaagtcagacgggagt
tcaataccaaagcacaaggcaaactttaagatcgaacctctgcacaataaatttcaggat
aaggatgcttggagactttccaaaagaaggggataa

DBGET integrated database retrieval system