KEGG   Theileria equi: BEWA_013780Help
Entry
BEWA_013780       CDS       T02820                                 

Definition
(RefSeq) N-acetyltransferase family member protein
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
beq  Theileria equi
Pathway
beq01100  Metabolic pathways
beq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:beq00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    BEWA_013780
Enzymes [BR:beq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     BEWA_013780
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 15804454
NCBI-ProteinID: XP_004832271
Position
4
AA seq 288 aa AA seqDB search
MDIHEYFRRIGFDGSKAKVDLETLTRILQCQLRTVPFENFTIHLGERMKMDLETVYDLVV
KKNRGGWCLQVNNLLAWALTEMGFQVTLLGGHVYNTTSEKYNDYMSHLVLTVPVNGKEYL
VDAGFGFSAQTWEPMELVSGKEHRQGPSVFRLIEDDGLWHVEQSKRERRFTKNGVVTSKP
AQGFVKVFNFTLKPRTTDNFVYINDFLQDYNDDIFATNSLCSLQTEDGVETLVGHTLTCV
KYDQNGVDLIDIKRLTDEEVYTELKCRFKLHLEKPFKPKKKDEEDILI
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggatatacacgaatactttaggaggatcggattcgatggctccaaagcaaaggtggat
ctggaaactctaacgaggatcctccaatgtcaactcagaacagttccatttgaaaatttc
acaattcacctcggtgaacgcatgaaaatggatttggagacagtttatgatcttgttgtg
aagaagaatcgcggtggctggtgccttcaggtcaataatcttcttgcctgggctcttacc
gagatgggcttccaggtcacattgctagggggacacgtttacaacactacctctgaaaag
tacaatgactacatgtctcatctcgtgctaacggtgcctgtaaatggcaaagaatacttg
gttgacgctggctttggattctcggctcagacatgggaacccatggagttggtttctggc
aaagaacaccgccagggaccgtcagtgttccgtttaattgaagatgatgggctctggcat
gtcgaacaaagcaaaagggaaagaaggttcactaaaaatggagttgtgacctccaaaccc
gcacaaggttttgtcaaagtcttcaacttcaccctaaaaccaaggaccacggataatttt
gtatacattaatgacttccttcaagactataatgatgatatatttgcaacaaactccctc
tgctccttacaaactgaagatggcgtagaaactttggttggtcatacacttacctgcgta
aaatacgatcaaaacggcgtagatttgatagatattaaaaggttgaccgatgaagaagtt
tacacagagttaaaatgcagattcaaacttcatctggaaaaaccatttaaaccaaagaag
aaagatgaagaagacatacttatttag

DBGET integrated database retrieval system