KEGG   Theileria equi: BEWA_019990Help
Entry
BEWA_019990       CDS       T02820                                 

Definition
(RefSeq) Helicase associated domain HA2 containing protein
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
beq  Theileria equi
Pathway
beq03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:beq00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    BEWA_019990
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:beq03041]
    BEWA_019990
Enzymes [BR:beq01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     BEWA_019990
Spliceosome [BR:beq03041]
 Complex C
  Other components
   Step II factors
    BEWA_019990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C DEAD ResIII AAA_22 Flavi_DEAD ABC_tran AAA_23 AAA_29 AAA_30 Helicase_RecD T2SSE RsgA_GTPase AAA_19 AAA_14 DUF2075 PhoH NB-ARC AAA_16 cobW TarS_C1 Sigma54_activat Zeta_toxin DUF87
Motif
Other DBs
NCBI-GeneID: 15806150
NCBI-ProteinID: XP_004828819
UniProt: L0AV76
Position
1
AA seq 676 aa AA seqDB search
MSFVLPVEQVREQILEKIRKHQVTVISGETGSGKSTIIPRIVYEKYLNERGNVVITQPRR
VAAISLCKYVSQLMNTKVGDVVGFKVRFFNKTSQNTRIKFVTDGILIREAIEDPLFTSYS
VLIIDEVHERSIRSDVLLGIIKLCLEKREDLKVIVMSATLECNNFQDFFPNSGYIHVPGR
QYPVDIFYMPKAYEDYIEAAMIAVLQINLTSNNGDVLVFLPGQDDIEVLEKLLKEKCDIL
DKSLKDYSKNNKVENAETLRKRANIKIGEMTYDMNKWKDLNILPLYAALSIDKQSLVFNE
TPKKCRKVVLATNIAETSLTIPGIRYVVDTGLAKERKFLTKSNFEALTINVISKASAKQR
AGRAGREGPGKIYRLYTFDSFNKMKEFSTPEIQSVDISNVYLELKMIGIKNPIEFPFVDP
PSKNSFLSAAMSLYRLGAITSNGVLTDTGKLMGKIPLLPIHSKLLLTSIEFECVSEILTI
VSMLSTEITFFENEKYNPGASKMRRSISHIHGDHLTLLNFYNLWDNAPSKDNICGQFGFN
NNAFLRASDIRKQLASVMMSNPINLVNITKCKDSTQWDNVRMCIAKSMWMNSAKLSVDSK
SYTTMVRNIQYSHSKQVNNQTVHIHPSSVLFNRQPLPGFIVYNECTSTKKVYIHNAIEIS
NEWLITYLPKWFKRNE
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgagctttgttttaccggttgaacaggtaagggaacagattttggagaaaataagaaaa
catcaagtgactgtgatatctggagagacaggtagcggtaaatctacgattatacccaga
attgtgtatgaaaaatatctaaatgaacgtggaaatgtagttattacacagcctaggaga
gtggctgcaatatctctctgtaaatatgtatcgcaacttatgaacacaaaggtaggagac
gttgtaggattcaaagtgagatttttcaataaaacaagtcaaaacactaggattaaattc
gttacagatggtatcctaataagagaagctatagaagatccacttttcacgagctattcc
gtccttatcatagacgaagtacatgaacgctccatacgctcggatgtgttacttggtatc
atcaagctgtgcctggaaaaacgagaggatttaaaggtcatagtaatgtcggctacactt
gaatgcaacaacttccaagatttctttccaaactctggttatatccatgtgcctggtaga
caatatcccgttgatatcttttacatgccaaaagcttatgaagactatatagaggctgca
atgattgcagtactgcaaatcaatttgaccagcaataacggcgatgtactggtattcctt
ccaggacaagatgatattgaggtacttgaaaaactcttgaaagaaaagtgtgatatattg
gacaaatcactcaaagattattcaaagaataacaaagtggaaaatgctgaaaccttgcga
aaacgagcaaatataaaaataggagaaatgacatacgacatgaacaagtggaaagactta
aacattcttccactatatgctgcattgtcaatagacaaacaatctttagtattcaatgag
acccctaaaaaatgtagaaaggtcgtgttggccacgaatatcgcagaaacatcactaact
ataccggggatacgctatgtagtagacactggtctggccaaagagaggaagtttctcaca
aaaagcaactttgaagcactgacaattaatgtaatttcaaaggcttcagcaaaacagcgt
gcaggaagagctgggagagaggggccagggaaaatatatcgcttatatacatttgattcg
tttaataagatgaaagagttctccactcccgaaattcaatctgtagacatttctaatgtg
tatctggagctgaagatgattgggattaaaaacccaattgaatttccatttgtggaccct
ccttctaaaaactccttcctatctgcggccatgagtttatatagactaggtgcaataact
tcaaatggagttttaacagacacagggaaattaatgggaaaaatacctctattacctatt
cactctaagctattgttaacatccatcgagttcgaatgtgtttcggaaattttgaccata
gtatcaatgttgtcaaccgaaatcaccttttttgaaaatgaaaaatacaatcctggagca
tctaagatgagaaggagtataagccatatccatggagaccatctgactctactcaatttt
tacaatttatgggacaatgcgccctcaaaagataatatatgcgggcaatttggattcaat
aataatgcatttctcagagcgagtgatatcagaaagcaactagcttccgttatgatgtct
aatcccataaatcttgtgaatattacaaaatgtaaagactcaacacaatgggacaatgtc
agaatgtgtatcgcaaaatcaatgtggatgaattctgcaaaactttcggttgattccaaa
tcgtacactactatggtaagaaatatacaatattcacattccaaacaggtcaacaatcaa
accgttcacattcatccatcttctgttttatttaatcggcaaccgcttcctggatttatc
gtttataacgagtgtaccagtacaaaaaaggtttatattcacaatgctattgaaatttcc
aacgaatggttgataacatatctaccaaaatggtttaaacgtaatgaataa

DBGET integrated database retrieval system