KEGG   Theileria equi: BEWA_031810Help
Entry
BEWA_031810       CDS       T02820                                 

Definition
(RefSeq) glutathione synthetase, putative
  KO
K21456  glutathione synthase [EC:6.3.2.3]
Organism
beq  Theileria equi
Pathway
beq00270  Cysteine and methionine metabolism
beq00480  Glutathione metabolism
beq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:beq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BEWA_031810
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BEWA_031810
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:beq04147]
    BEWA_031810
Enzymes [BR:beq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     BEWA_031810
Exosome [BR:beq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BEWA_031810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSH_synth_ATP GSH_synthase
Motif
Other DBs
NCBI-GeneID: 15803878
NCBI-ProteinID: XP_004829994
UniProt: L0AYK1
Position
1
AA seq 634 aa AA seqDB search
MENMSTLLVDLLSLFLCDLGPHKNSTICISKYAAVNTNDFNTKIIADVTHSFTSKARLLQ
NINKDCKLSYSNEASYTTFEGKTRLFNFVLAPLPYPLRIYERCKAFTPIFAQLIDEMCSH
LDELDELFSPITSVDPFVKGLLEISREVYGPNGRDYNKDIRVYINRADYILHSEEIAQQS
NSKTSNEELTYCRYCLYDYCMCNDREQVTFNNFGDSPEPDHKKLSAELVPKLVEINTIAT
SFSHASEFIFDLHKELIDSHKQREKLTRNTEMTHTENYPILSYVRTIISAHDLYLSRYPP
IFGKEKTCVLLLVDDYLLDDFDIYPISNLYKEHGVVTKIVHVEDLCNLMRQRKLLLVNEW
EVEDGSVRFTRVSTYYTEKKPGRLILLNNELDDSATLKDFTGCYEVSVLYYRTWYDPSCI
ESYKDAWSLRLLCEYSDAVKVPSAPAQLASSKRGQMIWSDPKHIDRLLASHKKRVKGEAY
NEELLDAVKETYILQVDPSLDVNAEIVNDAIQNPHRYVLKSQREGGFGVVYNSDISDALS
RGIENKGDVSHYVLMKRIIPPTQPSLFARNLNDETFEVELHNSITELGIFGFAVYDGNVC
KFNDTDGYLARTRSEFTKGNVCIDMGFINSLVFY
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atggagaacatgagtacactcttggttgaccttttgtctctattcttatgtgacttaggt
cctcacaaaaatagcacaatatgcattagcaagtatgcagccgtaaatacaaatgatttt
aataccaagattattgcggatgttacacattcgtttacatcaaaggctaggttgttgcaa
aatataaacaaagactgcaaattgtcttactcaaatgaagcgtcatatactacttttgaa
ggcaaaacaaggcttttcaactttgtcttggctcccttaccgtatcccttgaggatttat
gaaagatgtaaagcgtttacaccaatctttgctcagttaattgatgaaatgtgctcgcac
ttggatgaattggatgagttattctcgccaattacttctgtggatccttttgtaaagggt
ttactggagatatctagggaagtgtatgggcctaatgggagggactacaacaaggacatt
agagtatacattaacagagctgattacatactccattctgaagaaatcgcacaacaatca
aactcaaaaactagcaatgaggaactaacatactgcagatattgtctttatgactactgc
atgtgtaatgatagggagcaagttacatttaataatttcggagactctcctgaacctgat
cacaagaaactatccgctgaacttgtaccaaaattggtggaaattaatacgatagcgacg
tcgttttctcacgcatccgaatttattttcgaccttcacaaagagcttattgatagtcac
aaacaaagggagaaattaacgagaaatacggaaatgacacatactgaaaactacccaatt
ctgtcctacgtaagaaccattatatccgcgcatgatttatacctctcaagatatcctccc
atctttggaaaggaaaaaacgtgcgtgctacttctagtggatgactatctcttggatgat
tttgatatttatccaatctccaacctctataaggagcatggagtagtgacaaagattgta
catgtagaagacttgtgcaatttgatgaggcagaggaagttacttttggtaaatgaatgg
gaggttgaagatggatctgtgagatttacacgagtatcaacttactatacagaaaagaaa
cctggaagacttattctactcaataatgaacttgatgattccgcaacattaaaagacttt
acgggttgctacgaagtgagcgtattgtattacagaacttggtatgaccctagttgcatc
gaatcatataaagatgcttggagtttacgtttgctttgtgaatactccgatgcagtaaag
gttccatcagcacccgcacaacttgcttcgtcaaagagaggacagatgatatggagtgac
ccaaaacatatagatcgtctacttgcttctcacaaaaagagagtaaagggggaagcctac
aatgaggaacttttagatgccgtaaaggagacttacattttgcaggttgatccatccctt
gacgtcaacgctgaaattgtaaatgacgctatacagaatcctcatagatatgttttaaaa
tcgcaacgagaaggaggatttggagttgtatacaacagtgacatttcagatgcactttcc
aggggtatcgagaataaaggggatgtttctcactacgtgctcatgaaacgaatcattcct
cctacgcaaccatccttattcgccagaaatttaaatgacgagactttcgaggttgaactc
cacaatagcattaccgaacttggtatatttggttttgctgtatacgatggtaatgtctgc
aaatttaacgacactgatggttatctggcgagaacaagatctgagtttaccaagggaaac
gtgtgtatagatatgggatttatcaactctctggtattttactag

DBGET integrated database retrieval system