KEGG   Theileria equi: BEWA_032630Help
Entry
BEWA_032630       CDS       T02820                                 

Definition
(RefSeq) 6-phosphogluconate dehydrogenase, putative
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
beq  Theileria equi
Pathway
beq00030  Pentose phosphate pathway
beq00480  Glutathione metabolism
beq01100  Metabolic pathways
beq01110  Biosynthesis of secondary metabolites
beq01130  Biosynthesis of antibiotics
beq01200  Carbon metabolism
Module
beq_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:beq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BEWA_032630
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BEWA_032630
Enzymes [BR:beq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     BEWA_032630
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     BEWA_032630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 6PGD NAD_binding_2
Motif
Other DBs
NCBI-GeneID: 15806716
NCBI-ProteinID: XP_004830076
UniProt: L0AXZ0
Position
1
AA seq 463 aa AA seqDB search
MELCNEVGLVGLGVMASAYARNLYFRKVNISAWSRSSDEIAAFERKLDQEKPRSSSSEFG
SVKCFESLEDFVASLASPRKILILITAGSPVDSMLDKLIPLLQEGDIVVDGGNEWYLNTK
QRIERCKGFGIRFCGMGVSGGEQGARNHPCLMFGGEMEDYLQLFPIMSQDGKDFYVGTGA
SGHYVKMVHNGIEYAILQAIAEVYKVLKLVNGSENDEIAKLLGDWNRTEFKSYLLDITEM
ILQEKDNGDYIVDKITPSISSNGTGKWTVQDSFDRGIPVPSIGMSVDMRSFSNLLDLDVY
KIDSDGQKVDPENLRAAFRASLVSIFSQGIQLLTEASKEFDWGLEIDKVADVWSRNSIIS
CELLNAISEKYQRGSTNLLQVAELLKIVDENLAPWKKVVTDCINYNVTLPVITTSLQYVQ
VLLSKQHCHNLIQAQRDCFGSHGFNRVDLPGKHHHDWWRNRKQ
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggagctatgcaacgaagtcggtcttgtaggccttggagttatggctagcgcctatgcc
aggaacctatactttagaaaagtcaacatttcggcgtggagcagaagttctgacgaaatt
gcggctttcgagaggaaattggaccaagaaaagccacgaagcagttcttccgagtttgga
agtgttaaatgttttgaaagtttggaggattttgttgcgagtttggcgtctcccaggaaa
attttgatactgattaccgctgggagtcccgtcgattctatgctggacaaactcatcccg
ctcctgcaggaaggcgacattgtcgttgacggagggaatgagtggtatctcaacaccaag
caaagaattgagcgctgcaaaggctttgggattcgcttctgcggtatgggtgtaagcggc
ggagaacaaggcgccaggaatcatccctgtctcatgtttggaggcgagatggaagattat
cttcagctcttcccgatcatgtcccaagatggcaaggacttttatgtcggcactggtgcc
tctggacattacgttaagatggtgcataatgggatcgagtacgcaattttgcaggcgatt
gcagaggtttacaaggttctcaaacttgtaaatgggtcagagaatgatgagattgcgaaa
ttgctcggggactggaatcgcacagagttcaagtcgtatctgttggatattacggaaatg
atcttgcaggaaaaggataatggtgattacatagttgataagattaccccgagcatctcc
tccaacggaacgggaaagtggacagtgcaagactcgttcgatagaggaatcccagtaccc
tcaattggcatgtccgtggacatgagaagctttagcaacctccttgacttggatgtgtac
aagattgactctgacggacaaaaggtcgacccagaaaatctgagggctgcatttcgtgca
agtttggtgagcattttttcccaaggaatacagcttctaactgaagcttccaaggagttt
gactggggtctggagattgacaaggttgcagacgtgtggtcaagaaacagcattattagc
tgtgagctcctaaacgccatctctgagaaataccaaaggggtagtacgaacctgttgcaa
gtagccgaacttttgaaaatagtggacgagaatctagctccctggaaaaaagtagtgacg
gactgcataaactacaacgtcacacttcctgtaattacaaccagtctacaatacgttcaa
gtactcttgtccaaacagcactgtcacaatctgatacaagcacaaagagactgcttcgga
tctcatgggtttaatagagtggacttgccagggaaacaccatcacgattggtggaggaat
cgcaaacaatag

DBGET integrated database retrieval system