KEGG   Theileria equi: BEWA_033980Help
Entry
BEWA_033980       CDS       T02820                                 

Definition
(RefSeq) hypothetical protein
  KO
K15335  tRNA (cytosine34-C5)-methyltransferase [EC:2.1.1.203]
Organism
beq  Theileria equi
Brite
KEGG Orthology (KO) [BR:beq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:beq03016]
    BEWA_033980
Enzymes [BR:beq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.203  tRNA (cytosine34-C5)-methyltransferase
     BEWA_033980
Transfer RNA biogenesis [BR:beq03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    BEWA_033980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltr_RsmB-F FtsJ VitD-bind_III
Motif
Other DBs
NCBI-GeneID: 15803875
NCBI-ProteinID: XP_004830207
UniProt: L0AZW3
Position
1
AA seq 660 aa AA seqDB search
MEDLGENSSKTVQIEENNASSTKRTRLGWKSRCREMQGVRWNKKSNANQNKDNERRNYVE
GVPSNPEFEEYYRAQKICKDEEWDTFMEYNRKMLPVSFRLNTSVPLWKQTIEKLKEMVSE
DSELALRQCIDYSPEYLKPEDCIFYQMKTDKFSLRKNESFSRLHKFIMSEDNRGSLSRQE
TVSMLPVLFLDPQPNENILDLCAAPGMKYLQIIDIVESKLQFLEKLDSSKNKGIIIGNDI
CQNRVSTLSHHMKSLNSPSSAITNYDASRFPYLYNSNGEKILFDRILADMPCSCDGTLRK
SIEIWKTWKPTNGLHMHKIQLSILKRAIQILKPGGLLIYSTCSLNPLENEAIASYIASDE
GKELGVRLEPLKQIKGMKYATGVVDWFVPNPNGGHFEKYEQVDKSLHNRILPSMFKSENW
NAETASLVRRILPHHNDTGGFFIFAIRKNTSGYSSSDQLEVPDPVKTDTTDVISVESQKD
SKRKHANAGKLLHEFCLWKESDEDYSNVLKFYGIDKDADIVDQMIVKLSTKKSVYLFSKS
DVVYRGYKRKNSGDSNNRYELCKYALAGTRIFTQLKSKTIPVNCDLRITQEGTKVLYPYS
TRRKLFCNLVFGKLIIKGTISKDVLLEAESNNNLANLDSCKGAGGELESGGYIYMYKAKY
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atggaagatcttggggaaaatagcagtaaaactgtacaaatagaggaaaataatgcgtct
tctacaaagagaacgcgtctgggttggaaatccagatgtagagagatgcaaggagttcgc
tggaataagaaatccaacgccaatcagaataaagataatgaaagaagaaactatgtggaa
ggagtcccatcaaatcccgaatttgaagagtattacagggctcaaaaaatatgtaaagac
gaggaatgggatacattcatggaatacaatcgtaaaatgttgccagtttcatttagattg
aacacatcggtaccactatggaagcaaaccatagaaaaactgaaggaaatggtatctgag
gatagcgaactagccttgcgtcaatgcatagattattctccagagtatctaaaacctgag
gattgcattttttaccagatgaaaacggataaattttcactacgtaaaaatgaaagtttt
tctagactccacaaatttataatgtctgaggataatagaggttcattatctcgtcaagaa
actgttagcatgcttccagtgctttttcttgatccacagcctaatgaaaacattcttgat
ctatgtgcagcaccaggaatgaaatacttgcaaattatagatattgtagaaagtaaactc
caattcttagagaagttggatagctctaaaaataaaggcataataattggaaatgacata
tgtcaaaacagagtatctacgttgtctcatcatatgaaatcacttaattctccatcttct
gcgattaccaattacgacgcttcaaggttcccgtacctatataactctaacggggaaaag
atactcttcgacagaattttggcagacatgccatgtagctgtgatggtaccttgcgtaaa
tctatagaaatatggaagacttggaaacctacaaatgggttacatatgcataaaatccaa
ctgtcaatactcaaacgggccattcagattttgaagccaggtggattgttgatatactca
acttgctcgttaaatcccttagagaatgaggctattgcaagctatatagcatcggatgag
ggaaaggaacttggcgtaagattagaaccgttgaagcaaattaagggaatgaaatatgct
accggtgttgtagactggtttgtccctaatcccaatggtggtcattttgaaaaatatgag
caagttgataaatcattacacaatcgcattcttccttcaatgttcaagtcagaaaattgg
aatgcggagactgcgtcactagtgcgtcggattcttcctcaccataatgacactggtggt
ttctttatttttgccatacggaagaacacttcaggttattcctcctctgatcaattagaa
gttcccgatcctgttaagacagataccactgatgtgatttcggtcgaatctcagaaagat
tccaaaaggaagcatgctaacgctggaaaactattacacgagttctgtttatggaaagaa
tctgatgaagattacagcaatgtgctgaaattttacggaatagacaaggatgcggatata
gttgatcagatgattgttaagttatcgacaaaaaaaagtgtctacttgttttccaaatcg
gatgtcgtttacaggggttataagcgtaagaattctggcgattctaataacagatatgaa
ttgtgtaaatatgcattggctggaacgaggatattcacgcaattaaagtcaaagaccata
ccagtgaactgtgatttacgtataacgcaggaaggaacaaaagtactatatccttattct
acaaggcgcaagttattttgtaatcttgtatttgggaaacttattataaaggggacaata
agcaaggatgtcctgttggaagcagaatcaaacaataacttggcaaacttggatagttgt
aaaggtgcaggcggagaattagaaagtggaggctatatatatatgtacaaagcgaaatat
taa

DBGET integrated database retrieval system