KEGG   Theileria equi: BEWA_042770Help
Entry
BEWA_042770       CDS       T02820                                 

Definition
(RefSeq) methionine-tRNA synthetase, putative
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
beq  Theileria equi
Pathway
beq00450  Selenocompound metabolism
beq00970  Aminoacyl-tRNA biosynthesis
beq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:beq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BEWA_042770
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BEWA_042770
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:beq01007]
    BEWA_042770
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:beq03016]
    BEWA_042770
Enzymes [BR:beq01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BEWA_042770
Amino acid related enzymes [BR:beq01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BEWA_042770
Transfer RNA biogenesis [BR:beq03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BEWA_042770
 Prokaryotic type
   Other AARSs
    BEWA_042770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e
Motif
Other DBs
NCBI-GeneID: 15807687
NCBI-ProteinID: XP_004833691
Position
2
AA seq 587 aa AA seqDB search
MHIKYFYLIICINFPSLLCFNIFPGRKNVYLVPRNAKENEIKNRKLKSSFVDAEYASKNT
NGSFIITTPLFYINGDPHLGHSYTVVFADVIKRFLELKGNDVKLLVGTDEHGSKIERRSK
LFNQDPADYVSEYRSKFLNMFNAYDISSDISIHTDEEKNKLFVRQIFKILLKRGFIYRGI
HKGYFSPKEDLYFPQSQVSDGKSPQGFDVIPVNEPAYFFKLSSWRKKLTEFFIEHKTSVV
PETRYSEIMKILESELPDVAITRRNYTWGVKIPCVCDITPPVDCAIHGSSNYGITETFYV
WFDAFLGYLSGILSLSDENIDQILNDMTNKITNEIHRKSVLIQVIGKDILTFHSFLWPAI
LFSLGIQPFDKFYIHGWILCKGEKMSKSYGSVTPAMPLHSSDISRFMLMTLGQFGNDFEF
HSSNFRQSENTVRNTFAAACYRVTGLLNIRWNGKIEFPGKYYGNILDTLGSDQDILEGYI
TTGRVDRYMEHLETMAIKINKFLTLNKVWKLRPEEQNFKDIIWTACSSLLCLAVHTLPIM
PKLARTIISRLNPELNDTPIDQNKLRFAVLDSLERINYSPVHGEPLI
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgcacataaaatatttctatctcatcatatgtatcaattttccgtcgcttctttgtttc
aatatatttccagggcgcaaaaatgtgtatctggtgcctagaaacgctaaagaaaatgaa
attaaaaataggaagttgaagtctagttttgttgacgcagaatatgccagtaaaaataca
aatggatcgtttataataacaacccctcttttttatataaacggcgatccgcatttgggt
cactcatacaccgtagtttttgctgatgtcatcaagagattcttggaacttaaagggaac
gatgtaaagctactggtaggaacggatgagcatggctcaaaaatagaaagaaggtccaaa
ctatttaatcaggatcctgcagattatgtttcggaatataggagtaaattcctgaatatg
ttcaacgcctatgacatttcttctgatatttcaatacacactgatgaagaaaaaaacaaa
ctctttgtcagacagatattcaagatattgctaaaaagaggattcatatatcgagggatt
cacaaaggttatttttcgcctaaagaggacttatactttccacaatcacaagtttccgat
ggaaaatcacctcaaggatttgatgtaatcccagtgaacgaaccagcatatttttttaag
ttgagttcttggagaaagaaacttaccgaatttttcattgaacataaaacgtcggttgtt
ccagaaacgcgatatagtgaaattatgaaaattctggaatcagaacttccagatgttgca
atcacccgaagaaattatacttggggtgtaaaaataccttgcgtatgcgatattacccct
cctgttgattgtgctattcatggttcatcgaattatggtataactgagactttctatgta
tggtttgatgcatttttaggttatttatcaggtattttgtcactttcagatgaaaatatt
gatcaaattttaaatgacatgacaaacaaaatcactaacgaaatacacagaaagagcgtc
ttaattcaagtaatcggaaaggatatccttacttttcattcgtttttatggccagctata
ctgttttcattgggaatccagccgtttgataagttttatatccacggatggattttatgt
aaaggtgaaaaaatgtcaaaatcatatggatccgtgactccggcgatgccattgcattct
tctgacatttctagatttatgttgatgactttgggtcaatttggaaatgacttcgagttt
cattcctctaattttagacagtctgaaaataccgtaagaaatacattcgcagcggcatgt
tatagagtaactggtctcttgaacattaggtggaacggaaaaatagagtttcctggtaag
tattatggtaatatactagacactcttggctctgatcaagatatccttgagggctatatc
accactggaagagtagatagatacatggaacacctagaaactatggccatcaagatcaat
aaattcctgacactaaataaagtatggaaactacgacctgaagagcaaaattttaaagat
ataatatggactgcatgtagctcactattatgtctagctgtgcatacactaccgataatg
ccaaaactagcaagaacgatcatatccagattaaatcctgagttgaacgatactcccata
gaccaaaataaattaagatttgctgtcttagattcactagaaaggattaactattcccct
gtacatggggaaccgctaatttga

DBGET integrated database retrieval system