KEGG   Bdellovibrio exovorus: A11Q_1274Help
Entry
A11Q_1274         CDS       T02492                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bex  Bdellovibrio exovorus
Pathway
bex00071  Fatty acid degradation
bex00072  Synthesis and degradation of ketone bodies
bex00280  Valine, leucine and isoleucine degradation
bex00310  Lysine degradation
bex00362  Benzoate degradation
bex00380  Tryptophan metabolism
bex00620  Pyruvate metabolism
bex00630  Glyoxylate and dicarboxylate metabolism
bex00640  Propanoate metabolism
bex00650  Butanoate metabolism
bex00900  Terpenoid backbone biosynthesis
bex01100  Metabolic pathways
bex01110  Biosynthesis of secondary metabolites
bex01120  Microbial metabolism in diverse environments
bex01130  Biosynthesis of antibiotics
bex01200  Carbon metabolism
bex01212  Fatty acid metabolism
bex02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bex00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A11Q_1274
   00630 Glyoxylate and dicarboxylate metabolism
    A11Q_1274
   00640 Propanoate metabolism
    A11Q_1274
   00650 Butanoate metabolism
    A11Q_1274
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A11Q_1274
   00072 Synthesis and degradation of ketone bodies
    A11Q_1274
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A11Q_1274
   00310 Lysine degradation
    A11Q_1274
   00380 Tryptophan metabolism
    A11Q_1274
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A11Q_1274
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A11Q_1274
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A11Q_1274
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bex04147]
    A11Q_1274
Enzymes [BR:bex01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A11Q_1274
Exosome [BR:bex04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A11Q_1274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AGH95490
UniProt: M4VAL5
Position
complement(1294658..1295833)
Genome map
AA seq 391 aa AA seqDB search
MEKVVIVSAVRTPVASFQGAFAGLAAPRLGAIAIKAALEKVNVATTDVSEVIMGEVLTAG
VGQAPARQAAIYAGVSNSTPCLTINKVCGSGLKAVMLGADSIRLGTSKVVVAGGQENMTL
SPHLLENSRTGYRMGSQSIVDSMIKDGLWDPYNNFHMGNAAEVCSRDFEFTREAQDAFAI
DSYKKAQKAIAEGRFKNEICPVNIETKKGTVTVDTDEEPGKAMFDKMPQLRPAFEKEGTI
TAANASKLNDGAAALVLMSETEAKKRGLKPLATIVSYATFAQEPQYFTTAPVGAIKKSLE
LANLSVGDIDHFEINEAFANVTMAAQKSLEIPAEKTNIHGGAIAIGHPIGASGARILTTL
VHSLHTNNLKRGLATLCIGGGEAVSLIVERN
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaggtagttattgtttcagcagttcgtacaccggtcgctagctttcaaggagct
ttcgctggattagcagcacctcgcttaggagccattgccatcaaagccgcattagaaaaa
gtaaatgtcgcgaccacagatgttagcgaagtgattatgggtgaagttctcaccgcaggt
gttggacaagctcccgctcgacaagcggctatctacgcaggtgtttcaaattctactcct
tgcttaaccatcaacaaagtttgtggttcaggattgaaagccgttatgttgggtgcagac
agcattcgtcttggcacttcaaaagttgtcgttgctggtgggcaagaaaatatgacttta
tctcctcaccttttagaaaactcacgcacaggttaccgcatgggatctcaatctattgta
gattcgatgatcaaagatggtctttgggacccttacaacaacttccacatgggtaatgcc
gcggaagtgtgctcacgtgattttgaattcactcgcgaagctcaagatgcttttgctatt
gattcttataaaaaagctcagaaagctattgctgaaggacgttttaaaaatgaaatctgt
ccagtgaacattgaaacaaaaaaaggaactgtcactgttgatactgatgaagaaccggga
aaagctatgttcgacaaaatgccacagctacgccctgcttttgaaaaagaaggaacgatc
acagcagccaatgcctctaaacttaatgatggcgcagccgctttagttttaatgagcgaa
acagaagctaaaaaaagaggtttaaagcctcttgcgacgattgtctcttatgcgacattt
gctcaggaacctcaatacttcacaacagcacctgttggtgctatcaaaaagtctttagag
ctagctaatttaagcgttggggatattgaccatttcgaaatcaatgaagcttttgccaat
gtcacaatggccgcacaaaaaagcttagaaattcccgctgaaaaaacaaatattcatggt
ggagcaattgcgattggtcatcctatcggagcatcaggagcgcgtattttaacaactctg
gttcactcacttcatacaaataacttaaaacgcggtctagctactctttgtatcggtggc
ggcgaggccgtttctttaatcgtagaaagaaactag

DBGET integrated database retrieval system