KEGG   Bdellovibrio exovorus: A11Q_1589Help
Entry
A11Q_1589         CDS       T02492                                 

Definition
(GenBank) hypothetical protein
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
bex  Bdellovibrio exovorus
Pathway
bex00330  Arginine and proline metabolism
bex00332  Carbapenem biosynthesis
bex01100  Metabolic pathways
bex01130  Biosynthesis of antibiotics
bex01230  Biosynthesis of amino acids
Module
bex_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bex00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    A11Q_1589
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    A11Q_1589
Enzymes [BR:bex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     A11Q_1589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: AGH95805
UniProt: M4VBE3
Position
1614343..1615194
Genome map
AA seq 283 aa AA seqDB search
MASWSFLLHFLFCKIILIMAKKSKRIRWVVKAGSNMVCNGGPLLIKSWAQQVAQLRRDYN
IEVIWVSSGAIASAKSRIATNKIPKKNLKLNEKQALSAIGQPLVMDLYNMALQAESLRGA
QVLLTSDDLNHRGRRQNLKNTLQTLLKWDIIPVLNENDTVATEEIQFGDNDSLSARVAIH
MNADRLVILTDVDGLFDSDPTKNPQARLVPSLERVATKDLTQPGLKGKSQHGTGGMYSKL
LASRLATQKGIESFLVKGDLPSVLLQLAKGVSVGTHIKAKKSK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgtggagtttcttgcttcacttcctattctgtaagatcattttaatcatggcg
aaaaaatcaaagcgtattcgttgggttgttaaagcaggtagcaatatggtctgtaatggt
ggacctcttcttattaaatcatgggctcaacaagtggcccaattacgacgggattacaat
atcgaagttatatgggtttcgtcgggagctatcgcctctgcgaaaagtcgtatcgctaca
aataaaattcctaaaaaaaatctgaagctcaatgaaaaacaagctctttccgccatcgga
caaccgctggtgatggacctttacaacatggctttacaagctgagtctttgcgtggagca
caggtgcttttaacctctgatgatttgaatcatcgtggacgtcgtcaaaatttaaaaaac
actctacaaactcttttaaagtgggacattattcctgttcttaacgaaaatgatactgtt
gccacggaagaaatccaatttggtgataatgactcgttatccgcacgtgtggcgattcac
atgaatgctgatcgcttagttattctaacggatgtggacgggctattcgattcagatcca
actaaaaatcctcaggcaagattggtcccatcgctggaacgagtggcgacgaaggatctg
actcaacccggccttaagggaaagagtcaacatggcacaggtggaatgtactcgaagcta
ttggcttcacgtctagccacgcaaaaaggtatcgagagttttctggtcaagggcgatttg
ccttccgttcttttacaattagccaaaggagtctcggttggaactcatatcaaagctaaa
aaaagtaaataa

DBGET integrated database retrieval system